An increase in which of the following should cause management to reduce average inventory? a. The cost

Question:

An increase in which of the following should cause management to reduce average inventory?
a. The cost of placing an order
b. The cost of carrying inventory
c. The annual demand for the product
d. The lead time needed to acquire inventory

Fantastic news! We've Found the answer you've been seeking!

Step by Step Answer:

Related Book For book-img-for-question

Cornerstones of Cost Management

ISBN: 978-1285751788

3rd edition

Authors: Don R. Hansen, Maryanne M. Mowen

See More Books

Question Posted: Sep 01, 2015 04:50 AM

See More Questions

Sterling Corporation has an EOQ of 5,000 units. The company uses an average of 500 units per day. An order to replenish the part requires a lead time of five days. Required: 1. Calculate the reorder...
Desayuno Products, Inc., produces cornflakes and branflakes. The manufacturing process is highly mechanized; both products are produced by the same machinery by using different settings. For the...
Melchar Company uses 78,125 pounds of oats each year. The cost of placing an order is $18, and the carrying cost for one pound of oats is $0.45. Required: 1. Compute the economic order quantity for...
How to respond to the following? Cycle stock, pipeline inventory, buffer stock, and in-transit inventory all have associated carrying costs. Interest rates on inventory values, warehousing expenses,...
How might the short-term and long-term recruiting strategies differ?
Identify a 20-residue segment that could form a transmembrane helix in this protein sequence (from the mosquito protein Orco). FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT
A study has three experimental units and two treatments-A and B. List all possible treatment assignments for the study. How many are there? In general, show that there are $2^{N}$ possible treatment...
The Motuto Equipment Corporation maintains a general ledger account for each class of inventory, debiting the individual accounts for increases during the period and crediting them for decreases. The...
Required information [The following information applies to the questions displayed below] Wemerwoods Company uses a periodic inventory system. It entered into the following purchases and sales...
Can you make the journal entries for the transactions below: Dec. 1 - Sold merchandise to Argem Day Care Center for P20,000 and received a 3-month, 12% note. 2 - Purchased merchandise from Stephen...
System Duckstein, Inc., manufactures two types of aspirin: plain and buffered. It sells all it produces. Recently, Duckstein implemented a TOC approach for its Fort Smith plant. One binding...
For the theory of constraints, which of the following determines the production rate of the plant? a. Local efficiency measures that encourage production of excess inventory just in case demand is...
You purchase 3,000 bonds with a par value of $1,000 for $940 each. The bonds have a coupon rate of 8.4 percent paid semiannually, and mature in 10 years. How much will you receive on the next coupon...
When preparing a statement of cash flows using the indirect method, what information is needed? What documents or statements would be used?
The nation with the lowest cost of production has: a. a comparative advantage b. an absolute advantage c. an unfair advantage d. a competitive advantage
Describe the process for reconciling net income to the cash basis. What items are added to net income? What items are subtracted from net income?
Large firms can take advantage of: a. natural monopoly b. monopoly pricing strategies c. economies of scale d. collusion
Describe the difference between the direct and the indirect methods of preparing the operating section of the statement of cash flows.
Sketch the next figure in the pattern. XX
Could the owner of a business prepare a statement of financial position on 9 December or 23 June or today?
Consider the following actions of a college trying to manage the costs of its library. Required Match each of the process improvements listed with how they deliver cost reductions. Process...
Marvin's Kitchen Supply delivers restaurant supplies throughout the city. The firm adds 10 percent to the cost of the supplies to cover the delivery cost. The delivery fee is meant to cover the cost...
Marvin's Kitchen Supply delivers restaurant supplies throughout the city. The firm adds 10 percent to the cost of the supplies to cover the delivery cost. The delivery fee is meant to cover the cost...
1 0 . What type of passing parameter based on the following code fragment? class Student { public static void main ( String [ ] args ) { Student s = new Student ( Ali , 2 1 ) ; printData ( s ) ; }...
Observe changes occurred in value of all registers, which is accessed by operand in Debug Mode, then fill the blanks. (Write all esi value in L1 and ebx value in L2) TITLE Practice08-1 INCLUDE...
ALGORITHM Brute ForceClosest Pair(P) //Finds distance between two closest points in the plane by brute force //Input: A list P of n (n 2) points p(x1, y),..., Pn(xn, yn) //Output: The distance...

An increase in which of the following should cause management to reduce average inventory? a. The cost

Question:

Step by Step Answer:

b An increase in the cost of carrying inventory would lead to a ...View the full answer

Cornerstones of Cost Management

Students also viewed these Managerial Accounting questions