Identify a 20-residue segment that could form a transmembrane helix in this protein sequence (from the
Question:
Identify a 20-residue segment that could form a transmembrane α helix in this protein sequence (from the mosquito protein Orco).
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 40% (5 reviews)
To predict a potential transmembrane helix within a protein sequence you should look for a segment t...View the full answer
Answered By
HARSH RANJAN
Taken classes at college to graduates, Also worked as an expert to a freelancer online question-solving portal for more than 8 months with an average rating greater than 4.2 out of 5.
5.00+
1+ Reviews
10+ Question Solved
Related Book For
Fundamentals Of Biochemistry Life At The Molecular Level
ISBN: 9781118918401
5th Edition
Authors: Donald Voet, Judith G Voet, Charlotte W Pratt
Question Posted:
Students also viewed these Sciences questions
-
Proteins are synthesized with a particular amino acid sequence through the translation of information encoded in messenger RNA by an RNAprotein complex called a ribosome. Amino acids are specified by...
-
The behavior of receptor X (XR), a transmembrane protein present in the plasma membrane of mammalian cells, is being investigated. The protein has been engineered as a fusion protein containing the...
-
Let {Wt} be an SBM and define the process {Bt} by Bt = Wt t*W10/10, t [0, 10]. (a) For t [0, 10], what is the probability distribution of Bt? (b) Fix t [0, 10] and consider the bivariate random...
-
In Exercises, find the limit. lim (4x- x 16x - x
-
List the control features that directly contribute to the security of the computer center environment. Discuss.
-
The two most common isotopes of uranium are 235U and 238U. (a) Compare the number of protons, the number of electrons, and the number of neutrons in atoms of these two isotopes. (b) Using the...
-
Consider the multiple linear regression model fit to the baseball data in Problem 3.41. Problem 3.41 Consider the 2016 major league baseball data in Table B.22. While team ERA was useful in...
-
Foot Locker Inc. is the worlds number one retailer of athletic footwear and apparel. Headquartered in New York City, the company has over 44,000 employees and 3369 retail stores in 23 countries...
-
Mahalo Boat Adventure Inc. has a July 31 year-end. It showed the following partial amortization schedules regarding two bond issues: Bond Issue A (A) Cash Interest Paid (B) Period Interest (E)...
-
Macropinocytosis is a variation of endocytosis in which cells take up large amounts of extracellular fluid, which accumulates in intracellular vesicles. The drug vacquinol stimulates macropinocytosis...
-
Describe the labeling pattern of glycophorin A when a membrane- impermeable protein-labeling reagent is added to (a) A preparation of solubilized erythrocyte proteins; (b) Intact erythrocyte ghosts;...
-
A realtor in Mission Viejo, California, believes that the median price of a house is more than $500,000. a. Specify the competing hypotheses for the test. b. Using the MV_Houses data, calculate the...
-
You throw a ball straight up into the air. If air resistance affects the motion of the ball, which takes longer: the upward trip or the downward trip? Analyze using three different systems.
-
Mountain climbers know that it is harder to hike down a hill than to walk on level ground. Why is this so?
-
In 2012, the Australian government launched a new initiative that will pay employers to hire older workers. Employers will receive \($1000\) for every worker aged 50 or older that they hire and...
-
Identify all the forces exerted on the italicized object in each situation: (a) A book is lying on top of a magazine on a table. (b) A ball moves along a trajectory through the air. (c) A person is...
-
ISE Communications was one of the pioneers in using self-managed work teams. The teams were put in place to improve manufacturing flexibility and customer service, both factors being crucial in the...
-
1. Large data sets are more effectively analyzed and presented by: a. Showing each data point b. Graphing data in a chart c. Selecting the most important individual items d. None of the above 2. A...
-
Digital Fruit is financed solely by common stock and has outstanding 25 million shares with a market price of $10 a share. It now announces that it intends to issue $160 million of debt and to use...
-
S-adenosylmethionine (SAM) is a key methylating agent in several physiological processes, but its regeneration depends on the presence of another methylating agent. How is SAM regenerated?
-
Calculate the free energy yield for the complete oxidation of the carbon skeletons of (a) aspartate, (b) glutamine, and (c) lysine. Express your answer in ATP equivalents and assume that NADPH is...
-
Rationalize the significance of -ketoglutarate as an activator of glutamine synthetase?
-
Given the main memory with four frames and the reference string, answer the following question related to page replacement algorithms: 1,2,3,5,2,1,4,7,2,1,2,3,7,6,3,2,6,2,3,6 (4 Marks) 1. Calculate...
-
The adjusted trial balance for Happ Company follows. Adjusted Trial Balance December 31 Account Title Accounts receivable Accumulated depreciation-Trucks Accounts payable Salaries payable Number 101...
-
frequencies. Draw a Huffman tree and a coding table based on the following character h e $ g fow tmu 5 4 6 6 4 4 2 1 2 1 1 1 1
Study smarter with the SolutionInn App