Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones
Question:
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 50% (4 reviews)
Chaperones are specialized proteins that assist other proteins in folding correctly and preventing t...View the full answer
Answered By
Nazrin Ziad
I am a post graduate in Zoology with specialization in Entomology.I also have a Bachelor degree in Education.I posess more than 10 years of teaching as well as tutoring experience.I have done a project on histopathological analysis on alcohol treated liver of Albino Mice.
I can deal with every field under Biology from basic to advanced level.I can also guide you for your project works related to biological subjects other than tutoring.You can also seek my help for cracking competitive exams with biology as one of the subjects.
3.30+
2+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts And Connections
ISBN: 9780134641621
2nd Edition
Authors: Dean Appling, Spencer Anthony-Cahill, Christopher Mathews
Question Posted:
Students also viewed these Sciences questions
-
Managing Scope Changes Case Study Scope changes on a project can occur regardless of how well the project is planned or executed. Scope changes can be the result of something that was omitted during...
-
Why does it make sense to think of the return on a stock investment as a random variable? Does it make sense to think of the return on a bond investment that way? How about an investment in a savings...
-
Why does it make little sense to look for heterogeneity of effect sizes in this example? Bauer and Döpfmer (1999) examined the efficacy of lithium as an augmentation to conventional...
-
101, 115, 143, 106, 100, 142, 157, 163, 155, 141, 145, 153, 152, 147, 143, 115, 164, 160, 147, 150 (90%) Find the confidence interval of the median, indicated in parentheses, for the set of data.
-
How does bootstrap financing fit into the strategic plan of a new venture?
-
Explain the machining process with a neat sketch.
-
Following are errors, frauds, or other circumstances that an auditor might encounter as a result of applying audit tests to long-term debt as of the balance sheet date: a. Detailed long-term debt...
-
1. The project that Nationwide undertook was quite clearly a success. What made this possible? Discuss three different practices that helped Nation wide pull this off. Use examples from the case...
-
Jacob contributed $ 2 , 2 0 0 to charity within this past year, which qualifies for a tax deduction. Tucker saved $ 2 , 2 0 0 with a tax credit within this past year. Assume both Jacob and Tucker are...
-
In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
Racecar A is traveling on a straight portion of the track while racecar B is traveling on a circular portion of the track. At the instant shown, the speed of A is increasing at the rate of 10 m/s 2 ,...
-
The following table gives the probabilities that a certain computer will malfunction \(0,1,2,3,4,5\), or 6 times on any one day: Use the formulas which define \(\mu\) and \(\sigma\) to find (a) the...
-
Suppose that the probabilities are \(0.4,0.3,0.2\), and 0.1 that there will be \(0,1,2\), or 3 power failures in a certain city during the month of July. Use the formulas which define \(\mu\) and...
-
Prove that (a) = E(X2)-; (b) 33 +2.
-
A company manufactures hydraulic gears, and records show that the probability is 0.04 that one of its new gears will fail its inspection test. What is the probability that the fifth gear in a day...
-
An automated weight monitor can detect underfilled cans of beverages with probability 0.98. What is the probability it fails to detect an underfilled can for the first time when it encounters the...
-
Alan Norwood is currently a senior associate with the law firm of Butler, Starns, and Madden (BSM). His compensation currently includes a salary of $155,000, and benefits valued at $5,000. BSM is...
-
A simple random sample of 220 university students were asked what pasta they usually order and with which sauce. The preferences of these respondents are summarised below: Sauce Bolognese Pasta...
-
Is there a fundamental difference between the one- and two-electron reactions in the electron transport chain?
-
Why do the electron-transfer reactions of the cytochromes differ in standard reduction potential, even though all the reactions involve the same oxidationreduction reaction of iron?
-
What is the advantage of having a Q cycle in electron transport in spite of its complexity?
-
The LIGO interferometer is used to detect the very very small compression and expansion of space as a gravity wave passes by. It is essentially a Michelson interferometer, each of whose arms L1 and...
-
1. Why is steel a good material for cables? 2. What is wrong with a stone suspension bridge? 3. What is reinforced concrete?
-
Can you elaborate on the role of ethical leaders in promoting social responsibility and sustainability initiatives within organizations, and how do they balance the pursuit of profit with broader...
Study smarter with the SolutionInn App