Why is a type O individual considered a universal blood donor? Why is a type AB individual

Question:

Why is a type O individual considered a universal blood donor? Why is a type AB individual considered a universal acceptor?

Fantastic news! We've Found the answer you've been seeking!

Step by Step Answer:

Related Book For book-img-for-question

Biochemistry Concepts and Connections

ISBN: 978-0321839923

1st edition

Authors: Dean R. Appling, Spencer J. Anthony Cahill, Christopher K. Mathews

See More Books

Question Posted: Apr 21, 2016 04:16 AM

See More Questions

In another test, the valve of a 500-L cylinder full of the gas mixture at 2000 psi (gauge pressure) is opened wide so that the gas rushes out of the cylinder very rapidly. Why might some N 2 O...
Why is rotational latency usually not considered in disk scheduling? How would you modify SSTF, SCAN, and C-SCAN to include latency optimization?
For each of the following compounds, identify all groups that would be considered substituents, and then indicate how you would name each substituent. (a) (b) (c) (d) (e) (f) (g)
Fill in the blanks in the chart below: Year Years since 1960 1960 1965 1970 1975 1980 1985 1990 1995 1996 1997 1998 1999 2000 2001 2003 2005 2006 2007 2008 2009 2010 2011 0 5 [a] [b] [c] [d] [e] [f]...
On January 1, 2010, Sampress Company adopts a compensatory share option plan for its 50 executives. The plan allows each executive to purchase 200 shares of its $2 par common stock for $30 per share...
Aurora, Colorado, passed an ordinance banning pit bulls and other selected breeds of dogs from being inside the city limits. The American Canine Foundation, an organization aimed at improving the...
Consider the stock and bond lattices on the left of Figure 14.18. Each has unit cost of $\$ 1$ with the payoffs shown at the end nodes. There is a new asset available-a derivative of the first two...
A TV costs $900 including 20% sales tax. Find the new price if tax is reduced to 15%.
Again, as a consultant to Mr. Entrepreneur, you are asked to rank the proposals using the IRR (Internal Rate of Return) method. Which project should be selected under the IRR approach? What is the...
Production Strategy Better Fitness, Inc. (BFI) manufactures exercise equipment at its plant in Freeport, Long Island. It recently designed two universal weight machines for the home exercise market....
Provide an explanation for the fact that -D-mannose is more stable than -D-mannose, whereas the opposite is true for glucose.
The disaccharide Î±, Î²-trehalose differs from the Î±, Î± structure in Figure 9.14(a) by having an (a1Î²1) linkage. Draw its structure as...
Honda Motor Company, a Japan-based multinational and the worlds largest motorcycle manufacturer, was founded by Soichiro Honda in 1937. Honda, a Japanese engineer and innovator, built Honda Motor...
In the device shown in the Fig. 8.15 the bumper of mass $M=26.2 \mathrm{~g}$ is subject, in addition to the action of the spring of spring constant $k=3.40 \mathrm{~N} / \mathrm{m}$, also to a...
Consider the system shown in Fig. 6.8.. The spring has spring constant $k=500$ $\mathrm{N} / \mathrm{m}$ and rest length $L_{0}=25.0 \mathrm{~cm}$. Initially a mass $m=300 \mathrm{~g}$...
A material point of mass $m=500 \mathrm{~g}$ is suspended from a fixed point $\mathrm{O}$ by an inextensible wire of length $L=50 \mathrm{~cm}$. The material point, initially in an equilibrium...
An industrial electromechanical device (Fig. 6.9) is used to stop small objects in motion that have become negatively charged by electrostatic friction during production. The motion of such objects...
An object of negligible size slides on a horizontal plane and its initial speed is $v_{0}=4 \mathrm{~m} / \mathrm{s}$. The surface of the plane has increasing roughness and the corresponding...
Implement a generic BFS traversal using the template method pattern.
On August 31, 2012, the balances of the accounts appearing in the ledger of Wood Interiors Company, a furniture wholesaler, are as follows:Prepare the August 31, 2012, closing entries for Wood...
In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
Year 1 total cash dividends Year 2 total cash dividends Year 3 total cash dividends Year 4 total cash dividends $ 18,000 28,000 300,000 450,000 York's outstanding stock consists of 80,000 shares of...
Due to erratic sales of its sole product-a high-capacity battery for laptop computers-PEM, Incorporated, has been experiencing financial difficulty for some time. The company's contribution format...
Inventory turnover and number of days' sales in inventory Financial statement data for years ending December 31 for Tango Company follow: 20Y7 20Y6 Cost of goods sold $3,864,000 $4,001,500...

Why is a type O individual considered a universal blood donor? Why is a type AB individual

Question:

Step by Step Answer:

A type O individual does not produce the antigenic A or B oligosaccharides a...View the full answer

Biochemistry Concepts and Connections

Students also viewed these Medical Sciences questions