What kinds of organisms can fix nitrogen? Which ones cannot?
Question:
What kinds of organisms can fix nitrogen? Which ones cannot?
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 0% (1 review)
Nitrogenfixing bacteria symbiotic organism...View the full answer
Answered By
Mwangi Clement
I am a tried and tested custom essay writer with over five years of excellent essay writing. In my years as a custom essay writer, I have completed more than 2,000 custom essays in a diverse set of subjects. When you order essays from me, you are working with one of the best paper writers on the web. One of the most common questions I get from customers is: “can you write my essay?” Upon hearing that request, my goal is to provide the best essays and overall essay help available on the web. I have worked on papers in subjects such as Nursing and Healthcare, English Literature, Sociology, Philosophy, Psychology, Education, Religious Studies, Business, Biological Sciences, Communications and Media, Physical Sciences, Marketing and many others. In these fields, my specialties lie in crafting professional standard custom writings. These include, but are not limited to: research papers, coursework, assignments, term papers, capstone papers, reviews, summaries, critiques, proofreading and editing, and any other college essays.
My extensive custom writings experience has equipped me with a set of skills, research abilities and a broad knowledge base that allows me to navigate diverse paper requirements while keeping my promise of quality. Furthermore, I have also garnered excellent mastery of paper formatting, grammar, and other relevant elements. When a customer asks me to write their essay, I will do my best to provide the best essay writing service possible. I have satisfactorily offered my essay writing services for High School, Diploma, Bachelors, Masters and Ph.D. clients.
I believe quality, affordability, flexibility, and punctuality are the principal reasons as to why I have risen among the best writers on this platform. I deliver 100% original papers that pass all plagiarism check tests (Turnitin, Copyscape, etc.). My rates for all papers are relatively affordable to ensure my clients get quality essay writing services at reasonable prices.
4.50+
5+ Reviews
14+ Question Solved
Related Book For
Biochemistry
ISBN: 9781305961135
9th Edition
Authors: Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Question Posted:
Students also viewed these Sciences questions
-
Cyanobacteria are a large group of prokaryotic organisms. Cyanobacteria are found in marine microbial mats that include many species of Eukaryota and prokaryotic organisms that can participate in...
-
Nitrogen is a vital component of proteins and nucleic acids, and thus is necessary for life. The atmosphere is composed of roughly 80% N2, but most organisms cannot directly utilize N 2 for...
-
1) The strands of double stranded DNA are arranged in ___________fashion and form a__________ A) parallel.......Beta Pleated Sheet B) Anti-Parallel........Beta Pleated Sheet C)...
-
Linking every transport stakeholder together and ensuring seamless travel across Europe is a dream. With this objective, Amadeus, a leading global travel technology player, initiated a novel idea of...
-
Green River Company is preparing its master budget for 2012. Relevant data pertaining to its sales, production, and direct materials budgets are as follows. Sales: Sales for the year are expected to...
-
Find the open intervals where the functions graphed as follows are (a) Increasing, or (b) Decreasing. g(x) H -2 -2 H 2 4, HA fa X
-
Is the collision in Example 10.7 elastic? Data from Example 10.7 Pucks 1 and 2 slide on ice and collide. The inertia of puck 2 is twice that of puck 1 . Puck 1 initially moves at \(1.8 \mathrm{~m} /...
-
Thomas Railroad Company organizes its three divisions, the North (N), South (S), and West (W) regions, as profit centers. The chief executive officer (CEO) evaluates divisional performance, using...
-
Sub Saharan Africa: Be able to find Angola, Benin, Burundi, Burkina Faso, Chad, Cameroon, Democratic Republic of the Congo, Eritrea, Ethiopia, The Gambia, Ghana, Ivory Coast, Kenya, Madagascar, Mali,...
-
What is the Haber process?
-
How does the production of sugars by tropical plants differ from the same reactions in the Calvin cycle?
-
From experience, a shipping company knows that the cost of delivering a small package within 24 hours is $14.80. The company charges $15.50 for shipment but guarantees to refund the charge if...
-
Using the equations for standard deviation of the portfolio and Value-at-Risk (VAR) on pages 329 & 334 of the book to solve. 75% of portfolio is in USD (0.75) Use standard deviation for dollar of...
-
Miller Company's total sales are $126,000. The company's direct labor cost is $15,120, which represents 30% of its total conversion cost and 40% of its total prime cost. Its total selling and...
-
Using the issue of refugee resettlement as an example, demonstrate how every pairing is either wasteful or has justified envy. 3 groups G = (g1, g2, g3) Group size are s=1,5 = 1,53 = 2 2 localities L...
-
DM acquired 80%-of the equity shares in SZ on 1 January 20X1. The consideration for the acquisition consisted of the following: Cash of $4,800,000 paid on 1 January 20X1 Cash of $2,000,000 payable on...
-
A stock has a current selling price of $20. The distribution of the price of the stock one year from now is believed to be as follows: PRICE (x) PROBABILITY f(x) 20 .05 21 .06 22 .07 23 .08 24 .09 25...
-
Refer to the information in Problem 20-46. Required 1. Develop a business valuation for 2010 using the market value method, the book value method, and the multiples-based methods. 2. Determine an...
-
Sandcastles, Inc.s management has recently been looking at a proposal to purchase a new brick molding machine. With the new machine, the company would not have to buy bricks. The estimated useful...
-
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
Shown below are two cartoon views of the small globular protein StrepG in which an a helix is packed against a four-strand sheet. The sheet is made up of two -hairpins (a b-hairpin is a -turn-...
-
Pallette Manufacturing received an invoice dated, March 28 with terms 3/15, n/30. The amount stated on the invoice was $2008.00. (a) What is the last day for taking the cash discount? (b) What is the...
-
Pie Corporation acquired 75 percent of Slice Company's common stock on December 31, 20X5, at underlying book value. The book values and fair values of Slice's assets and liabilities were equal, and...
-
Hyde Restorations rebuilds factory facilities. It employs 1 3 0 full - time workers at $ 2 5 per hour. Despite operating at capacity, last year s performance was a great disappointment to the...
Study smarter with the SolutionInn App