Solve the given equations without using a calculator. 4x 3 16x 2 + 21x 9

Question:

Solve the given equations without using a calculator.

4x³ − 16x² + 21x − 9 = 0

Fantastic news! We've Found the answer you've been seeking!

Step by Step Answer:

Related Book For book-img-for-question

Basic Technical Mathematics

ISBN: 9780137529896

12th Edition

Authors: Allyn J. Washington, Richard Evans

See More Books

Question Posted: Apr 09, 2023 01:32 AM

See More Questions

Solve dx x d COS X dx + -cos x. y = 0
Solve the following Ordinary differential equation: (x2 + y?)dx + (2xy)dy = 0
Solve the differential equation 1 - + cot x- y3 sin x 0
The object is used to execute a static Oracle query, but the object is used to execute a dynamic Oracle query with IN and OUT parameters. a. PreparedStatement, Statement b. Statement,...
Consider the following reaction to produce methyl acetate: When this reaction is carried out with CH3OH containing radioactive oxygen-18, the water produced is not radioactive. Explain. CH,OH CH...
Fitzgerald, Inc., currently has an all-cash credit policy. It is considering making a change in the credit policy by going to terms of net 30 days. Based on the following information, what do you...
The United Nations Building in New York is approximately $87.5 \mathrm{~m}$ wide and $154 \mathrm{~m}$ tall. (a) Determine the drag on this building if the drag coefficient is and the wind speed...
On October 1, 2020, Mertag Company (a U.S.-based company) receives an order from a customer in Poland to deliver goods on January 31, 2021, for a price of 1,000,000 Polish zlotys (PLN). Mertag enters...
Using Georgia law, draft a client opinion letter to Brent on how the court will respond to the following scenario: Use the sources listed below and locate Georgia primary sources that are relevant to...
Find the remaining roots of the given equations using synthetic division, given the roots indicated. 5x 3 2x + 5x 2 = 0 (r 1 = j)
Perform the indicated multiplication. 12 -47 43 -18 36 -22 12 -1 1
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
31. Statement 1: All criminal violations of the National Internal Revenue Code may be compromised Statement 2: A criminal case for violations of the National Internal Revenue Code already filed in...
2023. Bank A Bank B Consider the following contingency table with the approved loans in August Consumer loans (approved out of total) Mortgage loans (approved out of total) p of 500 4 of 20 3000 of...
What regulatory framework/structure of the people development credit union and Downey finanacial corporation. how could the regulatory timely intervention prevent their situation. How effective...
Evaluate the challenges that MacDonald's has, and why promoting in-house talent is vital for Macdonald's vision?
How does the legal process of discovery encourage settlements during mediation? why or why not
What is the difference between positive economics and normative economics? Between microeconomics and macroeconomics?
The electric field due to a line charge is given by where l is a constant. Show that E is solenoidal. Show that it is also conservative. E =
Find all the inverses associated with the following functions and state their domains. f(x) = 2x/(x + 2)
A culture of bacteria has a population of 150 cells when it is first observed. The population doubles every 12 hr, which means its population is governed by the function p(t) = 150 2 t/12 , where t...
A capacitor is a device that stores electrical charge. The charge on a capacitor accumulates according to the function Q(t) = a(1 - e -t/c ), where t is measured in seconds, and a and c > 0 are...
Determine in each situation when capital investment analysis would be used. Purchase of a new delivery truck, which has an estimated useful life of five yearsDetermine if each statement would relate...
Suppose: Your gross salary is currently 45K annually. Your boss offers you to switch to a market-based contract: $30 K if the market is down or $80 K if the market is up, the market is equally likely...
What is the correlation between stocks X and Z? State of the Economy Probability of Occurrence Stock X Expected Return Stock Y Expected Return Stock Z Expected Return Recession 35% 25% -10% 15%...

Solve the given equations without using a calculator. 4x 3 16x 2 + 21x 9

Question:

Step by Step Answer:

We can try factoring this equation by grouping terms We can factor a 4x2 out of the first two ...View the full answer

Basic Technical Mathematics

Students also viewed these Mathematics questions