can you answer the think question please to this worksheet

In the article "LMO2 at 25 Years: A Paradigm of Chromosomal Translocation Proteins, the authors review the structure of a group of proteins called LIM-domain-only proteins, abbreviated LMOI, LMO2. LMO3, and LM04, that are proto-oncogenes. Some types of leukemia involve translocations in these genes The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 zinc finger regions are compared. There are three zinc fingers. A figure from the paper that compares the human and mouse primary sequences is shown here. Human: MSSAIERKSLDPSEEPVDEVLQIPPSULTOGGOQQNIGDRYFLKAIDQYWHEDCLSC Mouse: * Human: DLCGCRLGEVGRRLYYKLGRKLCRROYLRLFGOOGLCASCDKRIRAYEMTMRVKDKY Mouse: Human: YHLECEKCAACQKHFCVGDRYLLINSDIVCEQOIYEWTKINGMI Mouse: ** ****** THINK sets acids that define the zinc-binding motif. (Hint Remember that there are three zinc fingers!) Sketch the approximate secondary structure of the protein in this region, showing the zinc fingers and link regions