Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for...
Fantastic news! We've Found the answer you've been seeking!
Question:
Transcribed Image Text:
Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA Of the three, which one would migrate most slowly during chromatography through: (a) an ion-exchange resin; beads coated with positively charged groups? (b) an ion-exchange resin; beads coated with negatively charged groups? (c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these? (d) Which peptide contains the ATP-binding motif shown in the following sequence logo? Bits O 1 N CKT 2 3 4 5 6 7 8 C Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA Of the three, which one would migrate most slowly during chromatography through: (a) an ion-exchange resin; beads coated with positively charged groups? (b) an ion-exchange resin; beads coated with negatively charged groups? (c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these? (d) Which peptide contains the ATP-binding motif shown in the following sequence logo? Bits O 1 N CKT 2 3 4 5 6 7 8 C
Expert Answer:
Answer rating: 100% (QA)
a GPYFGDEPLDVHDEPEEG b ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG c GPYFGDEPLDVHDEPEEG d PHLLSAWK ... View the full answer
Related Book For
Posted Date:
Students also viewed these accounting questions
-
The balance sheet for Zeta Corporation is shown below in market value terms. There are 1.000 shares outstanding. Market value balance sheet Cash 200 Equity 11000 Liabilities 11200 Total Non-current...
-
2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 ARASIN22227 17 18 19 20 21 23 24 25 26 1) (2) Sales Price per unit Variable Cost per unit Contribution per unit Contribution Margin Ratio Break Even Point Sales...
-
2 3 4 5 6 7 8 9 10 11 12 13 14 Start Excel Download and open the file named EXP19 Excel Ch06 ML2 HW DeckBuilders.xlsx. Grader has automatically added your last name to the beginning of the filename...
-
Briar Company manufactures and sells dresses at a variable cost of $32 each and a fixed cost of x. It can sell 6,600 dresses at a selling price of $60 to earn an operating income of $14,800 (Option...
-
The L.A. dress shop produces custom designed dresses for retail sales on the premises. The shop sold 50 dresses last month. Costs incurred during the last month include e the following Cost of...
-
Identify the difference between 'traditional' and 'non-traditional' organizational structures. How does diversity play a role in each of these types of organizations?
-
Mikes Powersports uses the LIFO inventory method. Mikes Powersports started August with 10 helmets that cost \($54\) each. On August 19, Mikes Powersports bought 15 helmets at \($56\) each. On August...
-
Suppose you manage a sales department that uses the SaaS product Salesforce.com. One of your key salespeople refuses to put his data into that system. I just dont believe that the competition cant...
-
(a) Range of 2x + 10 =
-
When Corona leased farmland to a strawberry farmer named Armando Munoz Juarez, it claimed a security interest in his strawberry crop. Coronas financing statement listed the farmers name as Armando...
-
a) What is the nature of the direct effect of Internal Knowledge Sharing on Entrepreneurial growth (positive, negative, or no effect)? Provide two conceptual arguments for this effect. Use at least...
-
In its first year of operations, Martha Enterprises Corp. reported the following information: a. Income before income taxes was $640,000. b. The company acquired capital assets costing $2,400,000;...
-
International shipping charges from Paris to Rome is $4.28 per pound. You need to ship 50 bags of sugar, each weighing 3.5 kg. How much will it cost to ship the whole lot?
-
Suppose you drive an old truck with a 32 gallon gas tank thatgets 16 miles/gallon. If you are 75 miles from home and you have aquarter tank of gas, will you run out of gas before you get home?Show...
-
4] Fournier Inc. had a Machine that cost $50,000 6 years before and was being depreciated on a straight-line basis over 10 years with no estimated scrap value. The machine was sold at the beginning...
-
Discuss in detailed on why you feel it is important for either a pharmaceutical or forensic laboratory to have accreditation in various types of organizations that can undergo an accreditation...
-
how can i use this to fill the Excel form 09:56 man. 12. sep. 5 fx 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44...
-
a. What is meant by the term tax haven? b. What are the desired characteristics for a country if it expects to be used as a tax haven? c. What are the advantages leading an MNE to use a tax haven...
-
Write the expected electron configurations for the following atoms: Sc, Fe, P, Cs, Eu, Pt, Xe, and Br.
-
Fungal laccase, a blue protein found in wood- rotting fungi, is 0.390% Cu by mass. If a fungal laccase molecule contains four copper atoms, what is the molar mass of fungal laccase?
-
Predict the molecular structure for each of the following. (See Exercises 89 and 90.) a. BrFI2 b. XeO2F2 c. TeF2Cl3- For each formula, there are at least two different structures that can be drawn...
-
Describe the process of valuing the entrepreneurs ownership interest in a two-stage investment. Refer to Tables 13.10 and 13.13. Data from table 13.10 Data from table 13.13 Market potential...
-
Euro Exchange Rates. The exchange rate that we consider is the amount of euros that one can purchase for one U.S. dollar. We have \(T=699\) daily observations from the period April 1, 2005, through...
-
Evaluate the current yield curve level and structure using the following screens: a. YCRV or GC to access yield curves. b. FWCV to determine implied forward rates. c. USoo03M, USoo06M, USoo09M, and...
Study smarter with the SolutionInn App