Question: Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:

Chromatographic Methods Three polypeptides, the sequences of which are represented below using

Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA Of the three, which one would migrate most slowly during chromatography through: (a) an ion-exchange resin; beads coated with positively charged groups? (b) an ion-exchange resin; beads coated with negatively charged groups? (c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these? (d) Which peptide contains the ATP-binding motif shown in the following sequence logo? Bits O 1 N CKT 2 3 4 5 6 7 8 C

Step by Step Solution

★★★★★

3.36 Rating (152 Votes )

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock

a GPYFGDEPLDVHDEPEEG b ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG c GPYFGDEPLDVHDEPEEG d PHLLSAWK ... View full answer

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Accounting Questions!

Bonnie died on June 1, 2023, survived by her husband, Abner, and two sons, Carl and Doug. Bonnies only lifetime taxable gift was made in October 2020 in the taxable amount of $$13.25$ million. She...

The balance sheet for Zeta Corporation is shown below in market value terms. There are 1.000 shares outstanding. Market value balance sheet Cash 200 Equity 11000 Liabilities 11200 Total Non-current...

2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 ARASIN22227 17 18 19 20 21 23 24 25 26 1) (2) Sales Price per unit Variable Cost per unit Contribution per unit Contribution Margin Ratio Break Even Point Sales...

2 3 4 5 6 7 8 9 10 11 12 13 14 Start Excel Download and open the file named EXP19 Excel Ch06 ML2 HW DeckBuilders.xlsx. Grader has automatically added your last name to the beginning of the filename...

The manufacturing costs of Sige Enterprises for the first three months of the year are provided below. Using the high-low method, determine (a) The variable cost per unit and (b) The total fixedcost....

A. What is the sequence of the DNA that was used in the sequencing reaction shown in Figure Q109? The four lanes show the products of sequencing reactions that contained ddG (lane 1), ddA (lane 2),...

Assay of EPSPS EPSPS was assayed by following the disappearance of PEP. Reaction mixtures (Reaction A: total volume 0.5mL ) contained 3mM PEP, 3mMS3P,50mM Pipes buffer ( pH 6.6) and enzyme sample...

Human and horse insulin both have two polypeptide chains, with one chain containing 21 amino acids and the other containing 30 amino acids. They differ in primary structure at two places. At position...

The income statement and balance sheet for Rollins Company are provided below. Using the DuPont framework, compute the profit margin, asset turnover, assets-to-equity ratio, and resulting return on...

Identify the polar amino acids, the aromatic amino acids, and the sulfur-containing amino acids, given a peptide with the following amino acid sequence: Val! Met! Ser! Ile! Phe! Arg! Cys! Tyr! Leu

Stevie McQueen has run Lightning Car Detailing for the past 10 years. His static-budget and actual results for June 2015 are provided below. Stevie has one employee who has been with him for all 10...

John Jones is employed by RA Corporation, a large international corporation based in the Australia. According to his employment contract, which is enforceable in the Australia, Johns duties are...

Determine the roots of the following simultaneous nonlinear equations using (a) Fixed-point iteration and (b) The Newton-Raphson method: y' = x2 + x + 0.75 y + 5xy = x2 Employ initial guesses of x =...

what is the best way to connect with sponsors after an event?

Give me an example of business idea on mechanical engineering field with it\'s feasibility study.

5. Let a, = 1 and az = 1 and define %3D %3D an+2 An+1 + %3! Prove for all natural numbers n that 1

Show that each of the following subsets is a subspace of the given vector spaces, or else provide a single counterexample to show that the subset is NOT a vector subspace. o 5 All polynomials in p...

Using complex numbers find X. EX using Complex numbers Find X

Tefria Technologies Limited (TTL) is a small, start-up technology company in Ottawa that manufactures portable keyboards for mobile devices and tablets. TTL has been working to perfect a technology...

Service firms should focus on _____ costs in managerial decisions. Service firms should focus on costs in managerial decisions. variable fixed

Proteins are synthesized with a particular amino acid sequence through the translation of information encoded in messenger RNA by an RNAprotein complex called a ribosome. Amino acids are specified by...

This assignment focuses on arrays and file/text processing. Turn in a file named DNA.java. You will also need the two input files dna.txt and ecoli.txt from below. Save these files in the same folder...

Thank you I'll rate your answers Exposure to volatile organic compounds (VOCs, see below) in the workplace is subject to regulations and must be monitored regularly. Gas and liquid chromatographic...

Question: The following data set is derived from two different analytical methods analyzing the same samples. The samples contain different concentrations of acetylsalicylic acid (ASA) added to...

SPINACH CHROMATOGRAPHY QUESTIONS 1. why is it necessary to evaporate the acetone used to extract the pigments from spinach leaves and then redissolve the mixture in hexane before loading the column?...

(Multiple Choice: Only one answer is correct, and only one answer can be selected) The solid phase is the stationary phase and the liquid phase is the mobile phase. The solid phase is the stationary...