S
  1. study help
  2. subject categories
  3. computer science
  4. programming
  5. january 2020
  6. 31

Programming Questions and Answers January 31, 2020

Expert-verified solutions to help you succeed

Domain Name Servers are computers on the Internet that translate IP addresses to domain names, so the routers can pass the packets along to their destination IP address numbers.

q , assistant is a small program stored on a PC or portable device that monitors emails, faxes, messages, and phone calls. Virtual Real - time Autonomic Machine
q , assistant is a small program stored on a PC

Based on your ERD from POE Part 1 : For each entity's attributes identify the data type for each attribute. Create tables from entities. Normalize tables into 3 NF . Create database on PHPmyAdmin. Create all your tables on your database. Add sample data on your tables. NB: screenshot all your tables in the database and submit screenshots. ERD
Based on your ERD from POE Part 1 : For each

While relational database defines the table relationship via a foreign key, graph database explicitly defines and physically stores the relationship to improve query traversing speed. True False
While relational database defines the table

What determines which methods can be called on a variable? The parent class type. The type of the variable. The interface type. The type of the object.

Name the following; IUPAC and common name:
Name the following; IUPAC and common name:

Following was a first attempt at an ERD to depict the relationship between these entities. Upon initial reading, the following ERD seems correct; in that, each CAMPUS has one or more LIBRARIES. And each CAMPUS has many BOOKs. However, which BOOK is found in which LIBRARY?

Data stored in RAM is stored in pages that are: 2 MB in size. 4 MB in size. 4 KB in size. 4 TB in size. 4 GB in size.

By the aid of diagram please show the idea of Key Distribution Center ( KDC ) ? Please explain also the difficulty of detecting the key? [ 5 ]

Hi my company is designing a virtual postgres server, As a QA they have asked me to create a framework that test the virtual postgres server and compare that virtual postgres server acts like a postgres server. Could you please let me know the best framework and how to test it , any approach or code would be appreciated

what are the differences between cyberdeviants who do not intend harm to other computer users, or their computer systems and those who intend malicious damage and theft

please develop a NLP Chat bot for hotel room booking with user interface using html and javascript and backend using python. database should not be used

Suppose a transaction is written in C with embedded SQL , and about 8 0 percent of the time is spent in the SQL code, with the remaining 2 0 percent spent in C code. How much speedup can one hope to attain if parallelism is used only for the SQL code? Explain.

C + + ONLY PLEASE This assignment has three parts. First, you will need to have a Product structure which will be contained in the Store.h file. Its members are: int UPC string desc double qty In the Store.h file, which contains the Store class are the following private member variables: Member Variable Location Description storeNumber An int that

Security Policies | Attachment Protect Which one is NOT an option for Attachment Protection Delivery? Safe File with On - demand Sandbox Dynamic Configuration Safe File Safe File with Pre - emptive Sandbox
Security Policies | Attachment Protect Which one

What is not an example of a function? = RATE = PV = PMT = 1 5 * * 2 1
What is not an example of a function? = RATE = PV

Revision activity 6 a ) Explain what utility means in the economic sense,
Revision activity 6 a ) Explain what utility

What is the purpose of option - i in grep command? Invert the output of matching Ask for confirmation from user Perform case sensitive matching Perform case insensitive matching
What is the purpose of option - i in grep

When a Windows computer is configured to use DHCP but no DHCP server is available, what type of address is configured automatically for it ?

Part 2 ( week 7 ) : User - Defined Functions For this part of the practical, you're required to enhance your program from part 1 by including a user - defined function that handles the mathematics required to decode the resistor colour codes. Your program must be structured as follows: Your main MATLAB script must handle the user - interface
Part 2 ( week 7 ) : User - Defined Functions For

What are 3 different types of scanning in cyber security and why are they important?

Question 1 4 1 . 5 p t s Any computer that connects to an Internet Service Provider ( ISP ) becomes part of an ISP's network, whether it is a single computer or part of a local area network ( LAN ) at a workplace. True False
Question 1 4 1 . 5 p t s Any computer that

From Chapter 1 Stanford University's Artificial Intelligence Lab hosted the first - known video game contest with players competing in which of the following games? Tetris Atari Pong Spacewar
From Chapter 1 Stanford University's Artificial

ABC limited is in both computer hardware and software business

This question is related to problem 1 of PS 6 . A singlr - issue processor uses Tomasulo's Algorithm in its floating - point unit

all pods of your deployment keep restarting after 2 seconds

Q 2 ( 5 pts ) Assume that we have an application with a total of 1 , 0 0 0 , 0 0 0 instructions, 3 0 % of

code class = "asciimath" > cheak the stability o f the system i n h ( t ) problems

identifies active IP addresses, while Phishing; port scanning Eavesdropping; phishing Ping sweeping; port scanning Port scanning; ping sweeping
identifies active IP addresses, while Phishing;

In NoSQL databases, which of the following practices can help increase database throughput? Avoiding the use of sharding to keep data in one place Disabling caching to ensure real - time data updates Implementing data replication across multiple nodes. Using a single large database node to store all data

I need thee css code for the following array string [ ] FlowerName = new string [ 3 ] ; / / Hold three different models FlowerName [ 0 ] = "Aster Novae Angliae"; FlowerName [ 1 ] = "Aster Pantens"; FlowerName [ 2 ] = "Centaurea Cyanus Peg";

Who as implemented long distance phone service for business only

luke's company started upgrading the computers in your organization. as a security professional, you recommend creating a standard image for all computers with a set level of security configured. what is this process called?

Together, what are viruses, Trojans, and worms called? Group of answer choices Grayware Helpful software Malware Spyware

AAA ( authentication , accounting ) is only relevant for the edge ( perimeter ) of a network

uniform cost search always gives optimal solution, true or false ?

An illustration of a System Basic Startup, showing Language English, Host Name CorpNet, Wireless Network Name ( SSID ) Bluebonnet, with an arrow between the HostName and the Wireless Network Name ( SSID ) . You are configuring a wireless access point and are presented with the image shown below. Which of the following is the most correct statement

All PHP code must be included inside one of the three special markup tags recognized by the PHP Parser. Which of the following is NOT one of the three markup tags?
All PHP code must be included inside one of the

Which of the following statements are true about GPT - 3 ? Full form of GPT is Generative Pre - processed Transformer GPT - 3 is the first ever generalized language model. It's OpenAl's third iteration of model. All of the above
Which of the following statements are true about

Let A = 8 . 0 5 4 6 8 7 5 , B = - 1 . 7 9 9 3 1 6 4 0 6 2 5 x 1 0 1 . Then the exact result of A * B is 1 . 4 4 9 2 9 3 1 3 6 5 9 6 6 7 9 6 8 7 5 . Assume A and B are stored in the 1 6 - bit half precision format described in Exercise 3 . 2 7 . Let C be the product of A * B in the half precision format. Let D the decimal value of C = 1 . xxxxxxxx

For logistic regression, it is good to start with large initial weight values. Question 8 Select one: True False

I just written this code for this question, please see the message at the bottom after I have ran the code and please advise what could be wrong then fix it for me . We've loaded a dataset below relating to fraud on an E - commerce website. The fields in the dataset are 'user _ id ' , 'browser', 'age', 'purchase _ value', "fraud'. Find the count
I just written this code for this question,

The figure below shows a network where Client PC 1 wishes to establish a connection session with Server D . All communications between the two devices go through Routers NAT and R 2 . The IP and MAC addresses of each device are shown on the figure. Note that each router has two interfaces. Client PC 1 chooses TCP source port number 4 8 8 0 and the
The figure below shows a network where Client PC

iii. Which tidyverse package is primarily used for creating visualizations? A ) dplyr B ) tidyr C ) ggplot 2 D ) readr
iii. Which tidyverse package is primarily used

As Cameron searched through websites for the textbooks he needed for classes next semester, the websites would respond with study tools, technology cards, and other accessories they thought might interest him. This illustrates technology. Multiple Choice VPN Intranet 2 artificial intelligence Web 1 . 0
As Cameron searched through websites for the

Breadth - First Search ( BFS ) Problems ( 8 - 5 ) ( 8 - 6 ) ( 8 - 7 ) What is the Shortest Length of Path? \ table [ [ , , 8 - 1 , 8 - 2 , 8 - 3 , 8 - 4 , 8 - 5 , 8 - 6 , 8 - 7 ] , [ A , B , 2 ( 4 ) , 3 ( 5 ) , 3 ( 5 ) , 2 ( 4 ) , 1 ( 3 ) ( 3 ) , 1 ( 3 ) ( 3 ) , 1 ( 3 ) ( 3 ) ] , [ A , C , , , , , , , ] , [ A , D , , , , , , , ] , [ A , E , , , ,
Breadth - First Search ( BFS ) Problems ( 8 - 5 )

Individual Conditional Expectation ( ICE ) is the equivalent of PDP for each instance. Group of answer choices True False

Provide the description of the following diagram. bob and alice identical key

What are the four organization systems that every state has?

adaptive production lifeccycle agile method is often used to describe a variety of methods what are those methodologies and what are the deliverable characteristic

Q . 2 1 1 0 marks
Q . 2 1 1 0 marks

Given a real number x and a positive integer k , how many multiplications are used to find x 2 k by starting with x and successively squaring the appropriate number of times? Multiple Choice k multiplications 2 k + 1 multiplications 2 k - 1 multiplications k + 2 multiplications
Given a real number x and a positive integer k ,

Which of the following is not a recommended way to obtain information during debugging? Add "cout . . . " statements t o the code. Use a n autoamtic debugger t o view the values o f program variable. Add assert ( . . . ) statements t o the code, Form hypotheses a s t o what i s going wrong.
Which of the following is not a recommended way

Question 3 1 p t s What command on the Quick Parts drop - down menu would you use to create a building block from selected content in your document? AutoText Document Property Save Selection to Quick Part Gallery Building Blocks Organizer
Question 3 1 p t s What command on the Quick

Which of the statement is correct based on the letter A on the diagram? AA a . Supertype has optional subtypes. b . Every supertype occurrence is a member of at least one subtype. c . Subtype discriminator cannot be null. d . Subttype sets are not unique.

tLoads essential part of operating system ( kernel ) into memory tReads opening batch of instructions tDetermines hardware connected to computer

Write aVisual Basic program ot manage asmal inventory system for ofice stores. The program should alow hte userot ad new items ot the inventory, update item quantities, and remove items when htey are out of stock. ( 1 marks ) i . Use arrays ot store hte item information and implement functions and subroutines to handle hte diferent tasks such sa

In which type of storage location are the vector members stored? Choose one 5 points Contiguous storage locations Non - contiguous storage locations Contiguous & Non - contiguous storage locations Random storage locations

what layer is the Network Access layer in the TCP / IP Model?

Draw gate diagram for a given function Manually complete a truth table for the given function Build and simulate a logic circuit in Logisim for the function Determine the truth table for the function using Logisim Draw the gate diagram for the following Boolean Algebraic function. P ( x , y , z ) = z ( x + y ) + ( x + z )

What are the three roles in a scrum team? Scrum master, product owner, development team Collaborators, observers, team members Project manager, software architect, developers Project manager, business analyst. developers

What is the maximum possible speedup according to Amdahl's law

2 . 2 . 2 Identify any TWO countries in Southern Africa that are affected by warm 2 1 currents. q , q ,
2 . 2 . 2 Identify any TWO countries in Southern

key points in ethical AI in healthcare

Write this in c + + Final Assignment: Benchmarking Performance of the Sieve of Eratosthenes Instead of a final exam, you will be given a final project, where you compare the performance of the sieve of Eratosthenes with varying amounts of threads / processes and different sizes of workloads. This assignment will consist of the following parts: The
Write this in c + + Final Assignment:

To use or call function you need to specify

Which statement best describes when a WHILE loop should be used? When repeating a sequence of statements until the controlling condition is no longer true When assigning a value to a Boolean variable When the number of iterations is known When testing whether a variable is null

What is the output of the following console program? #include abc, a = b + c b = a + c c = a + b
What is the output of the following console

You can use a smaller hash table for both quadratic probing and double hashing than you can for linear probing. a . Trueb. False

An application within the data center requires 6 gbps of throughput with GCVE, which connection would be best utilized:L 2 Private VPNL 3 Routed VPNExpress RouteCloud InterconnectPartner Interconnect

What is the likely data sparsity of the LINE _ UNITS column? SELECT P _ CODE, SUM ( LINE _ UNITS ) FROM LINE GROUP BY P _ CODE HAVING SUM ( LINE _ UNITS ) > ( SELECT MAX ( LINE _ UNITS ) FROM LINE ) ;

The participant classes involved in the implementation of the Observer pattern are: A Subject class, an Observer class, a Concrete Subject class and a Concrete Observer class Question 1 9 options: True False

: Last Saturday, you went shopping and found a laptop on sale for $ 2 0 0 . The price was reduced by 5 0 % . You handed the cashier your credit card, and she said their system was not working and she could not take credit card payments. You insisted that you needed to pay by card because there was a sign that said Credit Card Accepted. The cashier

Shortest job first scheduling executes

A neural network is said to generalize when it properly classifies inputs that are not in the training set.

write the column with header "New" where each number is the product of the first value of Y ( 3 . 3 ) and the respective values of x ( the first number will be 3 . 3 * 1 0 5 , next 3 . 3 * 1 1 5 ) Also calculate the value of this expression using the Y vector above Y ' Y - ( y i ) 2 n = 1 0 8 . 7 5 0 7 6 9 2 < - - place the answer here where Y is

SDLC is also known as the waterfall method

What does API stand for in computer programming? A ) Application Programming Interface B ) Application Protocol Interface C ) Array Programming Interface D ) None of the above

A network authentication protocol that is highly susceptible to brute force attacks is: a . None of the options are correct b . SOCKS c . PAP d . SSL e . MS - CHAPv 2
A network authentication protocol that is highly

Which of the following is an example of a hedge? "sort of " "well, you know" "extremely" "isn't it ? "
Which of the following is an example of a hedge?

The illegal taking, misuse, or concealment of funds, property, or assets of a vulnerable elder is called what?

A person who analyzes, organizes, explores, and investigates an organization documents its business and also assesses the business model, and integrates the whole organization with modern technology ( 1 Point ) Business Analyst All of the above Computer Programmer Systems Analyst

Match the term to the correct amount of data. Drag and drop application. Petabyte ( PB ) Petabyte ( PB ) drop zone empty. Terabyte ( TB ) Terabyte ( TB ) drop zone empty. Gigabyte ( GB ) Gigabyte ( GB ) drop zone empty. Megabyte ( MB ) Megabyte ( MB ) drop zone empty. Kilobyte ( KB ) Kilobyte ( KB ) drop zone empty. One million bytes of data One

a keyword used to refer to the current object in a method or constructor

Jason, an attacker, has manipulated a client's connection to disconnect the real client and allow the server to think that he is the authenticated user. Which of the following describes what he has done? answer Active hijacking Cross - site scripting Passive hijacking Session sniffing

Problem 4 : Sequential Circuit Design ( 2 5 points ) You are interviewing to be digital designer at a reputed Semiconductor company. The interviewer asks you to design a STRING PARSER as a state machine that will take in an input string, consisting of sign, digits, and blank spaces, to output TRUE ( 1 ) if the string only contains valid integers
Problem 4 : Sequential Circuit Design ( 2 5

in c code Which is true for the following code? char userText [ 1 0 ] ; userText [ 0 ] = ' B ' ; userText [ 1 ] = ' o ' ; userText [ 2 ] = ' o ' ; userText [ 3 ] = ' k ' ; userText [ 4 ] = ' \ 0 ' ; . . . userText [ 3 ] = ' t ' ;

Review the JavaScript code that simulates the process of making a cup of coffee to identify the programming paradigms use. Discuss the potential issues that may arise from the code and propose a solution to resolve these issues.

Compute: z = x - | y | Ex: If the input is 5 . 0 4 . 0 , then the output is: need answer in java
Compute: z = x - | y | Ex: If the input is 5 . 0

1 . An array is . . . ( choose the best option ) A . a collection of various data types B . an immutable list C . an unordered collection of unique objects D . a collection of objects, each identified by a key, not a numerical index E . a collection of a single data type indexed by integer subscripts for use in numerical methods and statistical

Related Course Outcome: Task Scheduling & Monitoring.Requirement: Schedule a task with at and show the consequence of the scheduled task. ( 1 0 pts ) Extra credit: Schedule a task with crontab and show the consequence of the scheduled task. ( + 2 pts ) Provide evidence of the scheduled tasks and upload here. ( Linux command )

A biochemist isolates a peptide hormone with the following sequence: ADSERNCQLVILLAWLPGVKVQCALLDRET Which residues contribute a negative charge? ( Assume the residues are numbered 1 through 3 0 , left to right. ) D 2 , E 4 , D 2 7 , E 2 9 D 2 , E 4 , C 7 , D 2 7 , E 2 9 , T 3 0 D 2 , E 4 , D 2 7 , E 2 9 , T 3 0 D 2 , E 4 , C 7 , D 2 7 , E 2 9
A biochemist isolates a peptide hormone with the

Batch processing Operating Systems receive a set of jobs to run and then receive no additional input while the jobs are processing. Question 5 8 options: True False

After executing the following commands > > a = 2 > > b = a 3 > > c = power ( b , a ) > > c = c + 1 What is the value of c ? Answer this question without using MATLAB.
After executing the following commands style=

LFE ORIENTATION GRADE 1 2 PROJECT 1 . 4 Explain why knowing your rights and responsibility when using social media my improve the qlality of interaction with your online friends.
LFE ORIENTATION GRADE 1 2 PROJECT 1 . 4 Explain

When you use template names for page layout, a . you first define the grid areas and then assign elements to those areas b . you first define the template areas and then assign elements to those areas c . each element gets assigned to one template area d . each template area becomes one grid area
When you use template names for page layout, a .

Gaussian - based Color Segmentation Although Gaussian - based color segmentation is compact in terms of color model, it is computationally more intensive than the histogram - based model. Still, you can try this approach and compare with the previous one. You need to * Collecting flesh tone training data. A couple of images are provided. It is
Gaussian - based Color Segmentation Although

Considere una cadena de Markov que tiene una funci n de transici n P tal que P { x , y ) = ay , donde las ay son constantes. Espect culo que la cadena tiene una distribuci n estacionaria nica pi , dada por pi ( y ) = ayConsidere una cadena de Markov que tiene una funci n de transici n P tal que P { x , y ) = ay , donde las ay son constantes.

Let Y denote the number of heads in n flips of a coin, whose probability of heads is . ( a ) Suppose you assign a ( a , b ) prior distribution for , and then you observe y heads out of n flips. Show algebraically that your posterior mean of always lies between your prior mean and the observed relative frequency of heads. ( b ) Show that, if the
Let Y denote the number of heads in n flips of a

Why do employees often have an advantage over customers when it comes to theft in retail stores? Group of answer choices Employees have better access to store security procedures Employees are more likely to be caught by security Employees have less opportunity to steal Customers are more closely supervised

Showing 1300 - 1400 of 1506
  • 14 / 16