Part II$.10$ points

Convert the entity$-$relationship model below into a relational database schema. Examples of data are shown below the figure to allow you to determine domain constraints $($data types$).$ Assume all data will be in a similar format. Create the tables in your own MySQL database. You will not load data into these tables for this problem set. In grading this problem, I will look at your relational database schemas by using the DESCRIBE command in your database. In addition to the tables and columns, I will be checking for suitable data types, primary keys and whether a column must be set as "NOT NULL".

Example data:

Species id: $7227($the range for all ids is $1-100000)$

Scientific name: Drosophila melanogaster

Common name: fruit fly

Gene id $($all gene ids are in this format and have the same number of characters$)$: AF$052754$

Gene Description: epidermal growth factor receptor $($Egfu$)$ gene, complete cds$,$ alternatively spliced

Protein id $($all protein ids are in this format and have the same number of characters$)$: AAC$08536$

Protein Description $($the descriptions vary in length$)$: epidermal growth factor receptor isoform I

Protein Sequence $($this shows only part of the sequence$)$:

MLLRRRNGPCPFPLLLLLLAHCICIWPASAARDRYARQNNRQRHQDIDRDRDRDRFLYRSSSAQNR QRGGANFALGLGANGVTIPTSLEDKNKNEFVKGKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYV DGNLKLTW