Question: Write a program that decodes Base64 format using Python. Ex: Base64: aGVsbG8gd29ybGQ= Decoded: hello world

Write a program that decodes Base64 format using Python.
Ex: Base64: aGVsbG8gd29ybGQ=
Decoded: hello world

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer
Step: 1 Unlock blur-text-image
Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock
Step: 3 Unlock

Students Have Also Explored These Related Databases Questions!

Q:

Write a C program in main.c in directory unzipper that will be compiled into an executable unzip - per. Your program will read in a series of bytes in hexadecimal notation, representing the decoding...

Q:

dont use chat gpt - Problem 1 : The Decoding Ta ble Write a C program in main . c in directory unzipper that will be compiled into an executable unzip - per. Your program will read in a series of...

Q:

This assignment will require you to write a simple python script using the Python Standard Library. Python is available on our cs-ssh.uwf.edu server which runs Python 2.7.5.(python -V) I suggest you...

Q:

This text was adapted by The Saylor Foundation under a Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License without attribution as requested by the work's original creator or licensee. 1...

Q:

Hello I do need help with this Python3 programming, as well as the reflective questions. Thanks a lot. Background In this assignment you will be implementing a set of functions used in conjunction to...

Q:

Having trouble to do this Python3 programming and the reflective questions, help needed Thank you Background In this assignment you will be implementing a set of functions used in conjunction to form...

Q:

Need help with this python3 programming, as well as the reflective questions, thanks Background In this assignment you will be implementing a set of functions used in conjunction to form a website...

Q:

____________________________________________________________________________________ MessageIn.txt : HVWGWGHVSPSGHQCADIHSFSLSFQWGSWVOJSSJSFSLDSFWSBQSR...

Q:

Here is the text: This is a sample input file for COSC 1436 assignment #10. Your program should encode this file by adding six to the ASCII value of each character in it. In your encoded file the...

Q:

Write a C++ program that reads text from a file and encrypts the file by adding 6 to the ASCII value of each character. See section 5.11 in Starting out with C++ for information on reading and...

Q:

Review the Case Study presented below. After reviewing the Case Study, use the OSHA Construction Standards for Cranes and Derricks (Subpart CC) and steel erection (Subpart R) to prepare a list of...

Q:

A condo community management in Florida wants to improve the amenities they provide for their tenants. In order to make a more appealing selection of amenities, they want to estimate the mean age of...

Q:

13 Sofia is looking at the number sequence -14, -8,-2,4,... Read what she says. Is Sofia correct? Show all your working. The 50th term of this sequence is 280

Q:

CT Corp Comprehensive Question Canadian Tire Corporation, Limited ( Canadian Tire ) is a family of companies that includes a retail segment and a financial services division, among others. The retail...

Q:

8. Explain the relationship among identity, stereotyping, and prejudice.

Q:

6. Identify characteristics of whiteness.

Q:

9. Explain the relationship between identity and communication.