Question: Write a python code where you print out primary sequence with single letter amino acid codes and followed by a line indicating secondary structure, with

Write a python code where you print out primary sequence with single letter amino acid codes and followed by a line indicating secondary structure, with H for Helix, S for Strand/Sheet, and . everywhere else. As in the case of transmembrane helix, print 60 chars per line as shown in the example below (although the example shows 50 chars per line):

QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSM

...........SSSSSSS.....HHHHHHHHHHHH.....SSSSSS...HHHHHHHH...

LWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA

.........................HHHHHHHHHHHHHHHHHHHHHH.............

GDGAAATS

........

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock blur-text-image

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Databases Questions!

Working with FASTA data Modules you can use: sys (Links to an external site.) collections (Links to an external site.) os (Links to an external site.) re (Links to an external site.) argparse (Links...

""" Code file for M269 20J TMA01 Question 3. Student version 4: 24/03/20 """ """ The following table determines which amino acid is produced by a particular 3-base DNA codon. It uses a Python...

working with fast files, create 4 python scripts named nt_fasta_stats.py, secondary_structure_splitter.py, test_nt_fasta_stats.py , test_secondary_structure_splitter.py, .coveragerc, README.md...

Write a reference class called DNASequence. This will contain the name of a species (as a string) and a sequence of DNA nucleotides, also called bases. There are four kinds of bases: adenine (A),...

The goal of this project is to write a program that will translate DNA sequences into protein sequences using the 'standard' genetic code. Remember that coding DNA is 'read' as triplet 'codons,' each...

Kindly help to solve the questions with the use of the programmer, UCSF Chimera: Exploring protein structures in Chimera: This exercise walks through some of the features of Chimera that aid the...

Lesson 12 Quiz (Show/Explain all Work) IST 230 Relations on Sets, Databases 1. Let A = {0, 1, 2, 3, 4, 5, 6, 7, 8} and B = {1, 2, 3, 4, 5, 6, 7, 8}. Now let R be a binary relation R from A to B such...

in python..please follow rewuirements. program requirement. simple and clear write a function named clean_sequence() takes a string as its single parameter. It will use a for loop to go through the...

PLG-120 Week 4 Lecture Notes To begin your analysis of the legal issue you have been asked to address, you must identify the governing rule of law. Articulating the legal rule is, of course, the...

wrting programing python PLE HELP ME BY PYTHON, THIS IS ONE PROBLEM BUT IT 'S SO LONG. THANKS U SO MUCH DNA is made up of sequences of nucleotides. There are four nucleotides: Adenine, Cytosine,...

Do you think punishment can reduce the level of crime in a certain society? Justify your answer with the reference of Deterrent, Redistributive and Reformative theory.

Mickie Louderman is the new assistant controller of Pickens Publishers. She was the controller of a company in a similar industry, where she was in charge of accounting and had considerable influence...

Question 2 Which of the following recurrences cannot be solved directly by the Master Theorem? T ( n ) = 1 6 T ( n 4 ) + n T ( n ) = T ( n 5 ) + 2 0 T ( n ) = 3 T ( n 4 ) + n l o g n T ( n ) = 2 T (...

8:37 * N. 80% i ... OBJECTIVES: Create relationships Create a Pivot Table from Related Tables Create a PivotChart Modify the PivotChart The major section in this chapter :ontinuation is: Data...