You must cleave the following peptide into smaller fragments. Which of the proteases listed in Table 5-4

Question:

You must cleave the following peptide into smaller fragments. Which of the proteases listed in Table 5-4 would be likely to yield the most fragments? The fewest?
NMTQGRCKPVNTFVHEPLVDVQNVCFKETABLE 5-4 Specificities of Various Endopeptidases R-1 O Enzyme Trypsin Chymotrypsin Elastase Thermolysin

Fantastic news! We've Found the answer you've been seeking!

Step by Step Answer:

Related Book For  book-img-for-question

Fundamentals Of Biochemistry Life At The Molecular Level

ISBN: 9781118918401

5th Edition

Authors: Donald Voet, Judith G Voet, Charlotte W Pratt

Question Posted: