Question: Please answer if you are confident! 2. You are trying to develop a purification procedure to obtain a protein called thioredoxin from bacterial cells at

Please answer if you are confident!

2. You are trying to develop a purification procedure to obtain a protein called thioredoxin from bacterial cells at pH7.0. At this pH the protein contains: Total number of negatively charged residues =17 Total number of positively charged residues =12 What is the overall charge on this protein? Based on this answer, what type of column chromatography might be useful to purify this protein? Protein sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFH SLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Number of amino acids: 105 Molecular weight: 11737.5 Highlight all the amino acids in this protein that contribute to the negative charge

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock blur-text-image

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Chemical Engineering Questions!

Why do you need wireless services when adequate wired infrastructure exists in most parts of the United States?

chegg.com/homework-help/questions-and-answers/1-describe-vertical-chain-biotechnology-productions-make The CRP-1 Project: Current Applications Since Nucleon's founding, its main development project...

Nucleon 1) Describe the vertical chain for biotechnology productions. What "make" decisions has Nucleon already made? What "buy" decisions has it already made? Evaluate these decisions. 2) Draw a...

37.2021 X C 1) Describe The Vertical Chain Fo x Study.com - Search for courses, I x +...

Using the case study listed below, I need help with the following question Which option do you think management should take and provide justification? Think about this as you have two stages of...

Please answer below with elaborative justification from the attached cases below: What is similar and different about the two case companies? How important is the ProFusion platform to Adnexus?...

Research Report Students name Professors name Institution Date Contents Title .. 3 Abstract 3 Acknowledgement .3 Introduction .4 Main body of Report/Methodology 5 Various kinds of isolation.6...

Fact Find Initial Interview: Time Date Location Referred by: A. Personal Details Applicant 1 Applicant 2 Full Name of Applicant Full Name of Applicant Mr Mrs Miss OMS Dr Mr Mrs Miss OMs Dr Full Name...

ASSESSMENT TASKS - ASSIGNMENT 1 Page 2 ASSIGNMENT 1 Task Using the information contained in the Scenario below, please complete the following 6 tasks. You must complete each task for your submission...

please answer problem 2-3 correctly for a thumbs up please answer 1-3 and i will give a thumbs up Problem Ai financial bank you want the state to the contact with her to the bore point 55000 and...

Please answer the following questions. Working and/or explanations would be greatly appreciated The learning outcome of this assignment is to illustrate HTTP and its relationship to lower-level...

Find the inverse of each of the following 4 Ã 4 matrices, where k1, k2, k3, k4 and k are all nonzero. (a) (b) 000 00k 000 ka 000k 00kl 0k10 k100

Seven 1.0-cm-diameter tubes carrying steam at 100C are buried in a semi-infinite medium having a thermal conductivity of 1.2 W/m C and surface temperature of 25C. The depth to the centerline of the...

FBTR has a new project available on Arrakis. The cost of the project is $ 3 8 , 0 0 0 and it will provide cash flows of $ 2 1 , 4 0 0 , $ 2 7 , 3 0 0 , and $ 2 7 , 0 0 0 over each of the next three...

4. Change the code provided so that the blink rate is 0.5 seconds on and 1.5 seconds off and change the output port to pin 12. 5. Change comments and put them in your own rds to get a understanding...

2. How would you expect antitrust authorities to react to: LO21.2 a. A proposed merger of Ford and General Motors. b. Evidence of secret meetings by contractors to rig bids for highway construction...

3. For tax purposes, gross income is all the money a person receives in a given year from any source. But income taxes are levied on taxable income rather than gross income. The difference between...

1. Suppose a tax is such that an individual with an income of $10,000 pays $2,000 of tax, a person with an income of $20,000 pays $3,000 of tax, a person with an income of $30,000 pays $4,000 of tax,...