Please answer the following problems in their entirety using Python. Code all questions in a single Jupyter notebook 1. Compute the number of point mutations (i.e., the number of differences) between the two sequences "TAACT TATTTAATC" and "TGAATCATGGCAAT". 2. Print out each of the 6 reading frames of the DNA sequence "ATGGTCGTACTGACTTAA". Assume that this sequence is currently written in the 5' to 3' direction. 3. Using the first reading frame from the DNA sequence in problem 6, translate the DNA sequence to an amino acid sequence. 4. Write code that would check if a sequence is DNA or RNA. (You're looking for "U" in the string, but use a for loop and an if statement). 5. Concatenate the two DNA sequences "GAACGGA" and "TACGACCT" and print out the result. 6. At which index position does the substring "KLVFF" appear in the amino acid sequence "YEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV"?