Question: Predict the structure from the spectrum's below for C 9 H 9 Cl 1H NMR spectrum COSY spectrum 300 MHz Solvent: DMSO-de (solvent peak removed)

Predict the structure from the spectrum's below for C₉H₉Cl

1H NMR spectrum

Predict the structure from the spectrum's below for C9H9Cl 1H NMR spectrum COSY spectrum

COSY spectrum 300 MHz Solvent: DMSO-de (solvent peak removed) 2 ilulilu 5.6

300 MHz Solvent: DMSO-de (solvent peak removed) 2 ilulilu 5.6 5.4 5.2 mil 7.2 7.0 6.8 7.4 3 2 2 1 1 8 7 6 5 4 3 2 1 0 ppm 0 2 4 ppm 6 co 8 8 8 6 NE 2 0 4 ppm

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock blur-text-image

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Chemical Engineering Questions!

SQEELEEGKSSLVQSLDGDWLIDYAENGQGPVNFYAEDFDDSNFKSVKVPGNLELQGFGQ PQYVNVQYPWDGSEEIFPPQIPSKNPLASYVRYFDLDEAFWDKEVSLKFDGAATAIYVWL 1. Identify the source of your sequence and the location of the fragment...

Carbon disulfide (CS2) is a toxic, highly flammable substance. The following thermodynamic data are available for CS2(l) and CS2(g) at 298 K: (a) Draw the Lewis structure of the molecule. What do you...

Explain how a computer program can predict RNA secondary structure. What underlying genetic concept is used by the program to predict secondary structure?

The triene shown here reacts with 2 equivalent of maleic anhydride to yeild a product with the formula C17H16O6. Predict a structure for the product. 14-57 The triene shown here reacts with 2...

any help much appreciated Answer ALL parts The following scheme describes the synthesis of O from an acyclic precursor P. This is accomplished using two well-known organometallic transformations....

Pls. answer all especially #2 and #3. 1. Write a mechanism for the Diels-Alder reaction of anthracene and maleic anhydride. Be as complete as possible and show electron flow for all steps. *Note: Do...

5. Consider the following reaction. H2O2 (excess) NaOH BH3, THE B Intermediate A a. Predict the structure of Intermediate A (hint: it is a cyclic compound), then draw a mechanism for its formation....

I think this is what the structure is but can you confirm it and explain the peaks? (2p) Determine the structure of the following compounds using the Dven dI and riC NMR spectra. Draw the structure...

1.make a figure using PyMol or Chimera of the coronavirus protease. PDB ID: 6LU7 Sometimes the protein you are interested in does not have an experimentally determined structure. Thus, you may need...

Using the S&P 500 index as a proxy for the "market portfolio", what would be the estimated Beta for the Alphabet stock? Show your calculations. If you are using Excel, post an image of the section of...

Johnny is planning to expand his small bookstore to sell Compact Disks and DVDs. He needs your help. Create a program to manage Johnny?s inventory. The program must do the following: Allow entering...

If you borrow $ 1 5 , 0 0 0 today at 5 percent annual interest to be repaid in one year as a lump sum, this is termed a

Many mathematical models in engineering use exponential function. The general form of the exponential decay function is: (t)=Ae^(-T/t) where A is the initial value at t=0 and T is the time constant...

7. True or False. The MB = MC level of immigration is likely to be achieved if we simply let in every person who wishes to immigrate to the United States. LO25.5

2. Differences in productivity are usually the major force behind differences in wages and unit labor costs. Suppose that a single unskilled worker at a pottery factory in Mexico can produce 1 mug...

3. There is evidence that, other things equal, a 10 percent increase in the number of workers having a particular skill level leads to about a 4 percent decline in wages for workers with that skill...