Question: Take the sequence below and enter into the YASPIN server ( http: / / www . ibi.vu . nl / programs / yaspinwww / )

Take the sequence below and enter into the YASPIN server (http://www.ibi.vu.nl/programs/yaspinwww/). If YASPIN is down, use SYMPRED. Count the number of helices and sheets and find the largest stretch for each structure type. >SARS coronavirus protein E MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEG VPDLLV

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer
Step: 1 Unlock blur-text-image
Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock
Step: 3 Unlock

Students Have Also Explored These Related Databases Questions!

Q:

This question concerns lexical grammars. (a) Tree Adjoining Grammars contain two types of elementary tree. (i) What are these trees called? [1 mark] (ii) If one were building a grammar for English...

Q:

Hello, I'd like to have this lab homework done, thank you. 5 1241109 2x Blackboard-Expiratione 16160256000008.X-Blackboard Signature PNUSTTISZW 3ely WcAlecHpD271DZvyR%2FhZKEc30 1 / 4 100% + LASP 550...

Q:

Please read the question Question: Choose another different one of the teaching strategies from the article that you read 1. What is the teacher is trying to accomplish by using this technique? (That...

Q:

Please read the question Question: Choose one of the teaching strategies from the article that you read 1. What is the teacher is trying to accomplish by using this technique? (That is, what's the...

Q:

it is! yes Lab 02: locane Powder Overview Man in Black: All right. Where is the poison? The battle of wits has begun. It ends when you decide and we both drink, and find out who is right... and who...

Q:

NO PLAGIARISM, NO PLAGIARISM, NO PLAGIARISM!!!! PYTHON AND USE CS50 IDE https://cs50.harvard.edu/x/2021/psets/6/dna/ DNA Implement a program that identifies a person based on their DNA, per the...

Q:

Sequence of Double Numbers Implemented with an Array The Problem You will implement and test a Sequence of Double Numbers Implemented with an Array as described in the documenation...

Q:

public class DoubleArraySeq implements Cloneable { // Invariant of the DoubleArraySeq class: // 1. The number of elements in the sequences is in the instance variable // manyItems. // 2. For an empty...

Q:

Man in Black: All right. Where is the poison? The battle of wits has begun. It ends when you decide and we both drink, and find out who is right... and who is dead. The line above is from the...

Q:

please write the code in java language try to write all methods public void advance( ) { assert wellFormed() : "invariant failed at start of advance"; // TODO: Implement this code. assert...

Q:

Account Title Cash Office Supplies Prepaid Insurance Equipment Accumulated Depreciation Equipment Accounts Payable Salaries Payable Unearned Revenue Maiden, Capital Maiden, Withdrawals Service...

Q:

Internal standards are commonly used in chromatography to calculate the concentration of an analyte. For any particular detector, the relative response factor for the analyte compared to the internal...

Q:

Given the following choices, indicate the location of the item on ABC's Statement of Cash Flows. Sale of Fixed Asset for Cash: Select one: a . Operations Section b . Investments Section c . Financing...

Q:

CT Corp Comprehensive Question Canadian Tire Corporation, Limited (Canadian Tire) is a family of companies that includes a retail segment and a financial services division, among others. The retail...

Q:

4. How has e-commerce affected business-to-business transactions?

Q:

1. How important is mobile technology in Orbitzs business strategy? Why? When it comes to mobile apps and gauging their impact on consumers and business, the online travel industry and its airline...

Q:

1. Analyze Pandora using the value chain and competitive forces models. What competitive forces does the company have to deal with? What is its customer value proposition? Pandora is the Internets...