The following sequence is part of a globular protein. Predict the secondary structure in this region. .
Question:
The following sequence is part of a globular protein. Predict the secondary structure in this region.
. . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 40% (5 reviews)
RRPVVLMAACLRPVVFITYGDGGTYYHWYH Its not possible to predict the exact secondary structure of this reg...View the full answer
Answered By
Shristi Singh
A freshman year metallurgy and material science student in India.
4.80+
2+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts And Connections
ISBN: 9780134641621
2nd Edition
Authors: Dean Appling, Spencer Anthony-Cahill, Christopher Mathews
Question Posted:
Students also viewed these Sciences questions
-
Explain the following three observations. (a) Silk, like most polypeptides with sheet structures, is water insoluble. (b) Globular proteins such as myoglobin generally dissolve readily in water. (c)...
-
The protein ribonuclease A in its native, or most stable, form is folded into a compact globular shape: Native ribonuclease A (a) Does the native form have a lower or higher free energy than the...
-
In Problems, assume that the shaded region is part of a vertical side of a tank with water (δ = 62.4 pounds per cubic foot) at the level shown. Find the total force exerted by the water...
-
John Black is considering to purchasing a land from Real Estate Ltd for $1,000,000. The terms of the agreement are, 10% down payment, and the balance is to be repaid at 20% interest for duration of...
-
How can personal selling be used to build long-term customer relationships?
-
What are the advantages of a planer ?
-
Following are selected questions from an internal control questionnaire relating to a company's debt and equity transactions. A \/es response to any question indicates a potential strength of the...
-
Kathy Myers frequently purchases stocks and bonds, but she is uncertain how to determine the rate of return that she is earning. For example, three years ago she paid $13,000 for 200 shares of Malti...
-
Norse LLC , an accrual basis computer manufacturer, began offer a two - year warranty on their computers sold in 2 0 X 1 . Based upon 2 0 X 1 sales they have recorded a warranty liability of $ 7 5 ,...
-
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
-
Shown below are two cartoon views of the small globular protein StrepG in which an a helix is packed against a four-strand sheet. The sheet is made up of two -hairpins (a b-hairpin is a -turn-...
-
Consider the following statement: All present-day cells have arisen by an uninterrupted series of cell divisions extending back in time to the first cell division. Is this strictly true?
-
Particle 1 , carrying charge \(q\), particle 2 , carrying charge \(2 q\), and particle 3 , carrying charge \(-q\), are located at the vertices of an equilateral triangle of side \(\ell\) in the \(x...
-
Two charges of equal magnitude, \(2 \mu \mathrm{C}\), are separated by a \(2 \mathrm{~cm}\) distance. Compare the electric force if the separation is increased to \(6 \mathrm{~cm}\).
-
Environmental engineers, concerned about the effects of releasing warm water from a power plants' cooling system into a Great Lake, decided to sample many organisms both inside and outside of a warm...
-
Two identical metal spheres carrying the same charge hang by insulating strings from the same point. The balls repel each other so that they hang in the air some distance apart. If you touch one of...
-
Prove that for the Poisson distribution \[\frac{f(x+1 ; \lambda)}{f(x ; \lambda)}=\frac{\lambda}{x+1}\] for \(x=0,1,2, \ldots\)
-
Jan and Sue have engaged successfully as partners in their law firm for a number of years. Soon after their states incorporation laws are changed to allow professionals to incorporate, the partners...
-
l ask this second time correnct answer is 38,01 can we look pls Consider a non-conducting rod of length 8.8 m having a uniform charge density 4.5 nC/m. Find the electric potential at P, a...
-
What is the advantage of having mobile electron carriers in addition to large membrane-bound complexes of carriers?
-
Cytochrome oxidase and succinate-CoQ oxidoreductase are isolated from mitochondria and are incubated in the presence of oxygen, along with cytochrome c, coenzyme Q, and succinate. What is the overall...
-
Do all the respiratory complexes generate enough energy to phosphorylate ADP to ATP?
-
How do ethical leaders navigate ethical gray areas and conflicting stakeholder interests while upholding ethical standards and ensuring the long-term sustainability and reputation of the organization...
-
A report on Blockchain in the context of Fintech and RegTech need to be written. The company wants to use blockchain for three purposes 1. As a mechanism for secure digital transactions and smart...
-
How is 7%, 10%, and 15% calculated under the following "Discount Rates Applied to the CFs:" highlighted below. Data below. Please include formulas and information on how problem is solved. INPUT...
Study smarter with the SolutionInn App