Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones
Question:
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 50% (4 reviews)
Chaperones are specialized proteins that assist other proteins in folding correctly and preventing t...View the full answer
Answered By
Nazrin Ziad
I am a post graduate in Zoology with specialization in Entomology.I also have a Bachelor degree in Education.I posess more than 10 years of teaching as well as tutoring experience.I have done a project on histopathological analysis on alcohol treated liver of Albino Mice.
I can deal with every field under Biology from basic to advanced level.I can also guide you for your project works related to biological subjects other than tutoring.You can also seek my help for cracking competitive exams with biology as one of the subjects.
3.30+
2+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts And Connections
ISBN: 9780134641621
2nd Edition
Authors: Dean Appling, Spencer Anthony-Cahill, Christopher Mathews
Question Posted:
Students also viewed these Sciences questions
-
Managing Scope Changes Case Study Scope changes on a project can occur regardless of how well the project is planned or executed. Scope changes can be the result of something that was omitted during...
-
Why does it make sense to think of the return on a stock investment as a random variable? Does it make sense to think of the return on a bond investment that way? How about an investment in a savings...
-
Why does it make little sense to look for heterogeneity of effect sizes in this example? Bauer and Döpfmer (1999) examined the efficacy of lithium as an augmentation to conventional...
-
101, 115, 143, 106, 100, 142, 157, 163, 155, 141, 145, 153, 152, 147, 143, 115, 164, 160, 147, 150 (90%) Find the confidence interval of the median, indicated in parentheses, for the set of data.
-
How does bootstrap financing fit into the strategic plan of a new venture?
-
An L-R-C series circuit has R = 500 , L = 2.00 H, C = 0.500F, and V = 100 V. (a) For w = 800rad/s, calculate VR, VL, VC, and Ф. Using a single set of axes, graph v, VR, VL, and VC as functions...
-
What reasons can you give in support of, and against, the development of separate financial accounting guidelines and standards that reflect the financial consequences of environmental issues?
-
Julia Dumars is a licensed CPA. During the first month of operations of her business, Julia Dumars, Inc., the following events and transactions occurred. May 1 Stockholders invested $20,000 cash in...
-
As an up-and-coming manager at BP (UK), you were anxiously anticipating the offer of another assignment abroad and you were reassigned and deployed from Stark to BP's Japanese subsidiary.You have...
-
In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
If a 1-L container is immersed halfway into water, what is the volume of the water displaced? What is the buoyant force on the container?
-
Huxley Horticulture Ltd has $200,000 (face value) of 10-year bonds outstanding. Each $1,000 bond carries a 5% coupon, paid semi-annually, and is currently selling in the market for $950. They also...
-
A pipe of radius 1 . 3 m narrows to 0 . 4 m . If the fluid is traveling at 2 . 1 m / s in the larger radius pipe, calculate the fluid speed in the narrower pipe.
-
How does quality as a measure of reliability create competitive advantage for a firm? It eliminates the need for customer service. It improves responsiveness to customer needs. It increases value for...
-
A 25.0g block of silver is heated from 26.0 C with 125 J of heat. What is the final temperature of the block?
-
An angry recording musician throws his microphone at 38.0 km/h directly away from a guitar amplifier that is playing a constant (pure) tone. During this process, the microphone records a frequency of...
-
Refer to The American Association of Nurse Anesthetists Journal (Feb. 2000) study on the use of herbal medicines before surgery, presented in Exercise. Recall that 51% of surgical patients use herbal...
-
l ask this second time correnct answer is 38,01 can we look pls Consider a non-conducting rod of length 8.8 m having a uniform charge density 4.5 nC/m. Find the electric potential at P, a...
-
Is there a fundamental difference between the one- and two-electron reactions in the electron transport chain?
-
Why do the electron-transfer reactions of the cytochromes differ in standard reduction potential, even though all the reactions involve the same oxidationreduction reaction of iron?
-
What is the advantage of having a Q cycle in electron transport in spite of its complexity?
-
Police officers are called to the house at 268 South Main Street after a neighbor notices newspapers piling up at the front door. The house is occupied by Carl, his wife Becca, and two small...
-
Derby State University is a four-year public institution of higher education that features a robust and award-winning STEM curriculum. Located in the Southern United States, the heritage of...
-
Moving Up Chemical Productions Pty Ltd ('the company') holds an environment protection licence ('EPL') under the Protection of the Environment Operations Act 1997 (NSW) ('the POEO Act') in relation a...
Study smarter with the SolutionInn App