Question: need help with number 2 1. The protein mixture is run through several separation techniques, depicted below, one after the other. The elution from each

need help with number 2 need help with number 2 1. The protein mixture is run through

1. The protein mixture is run through several separation techniques, depicted below, one after the other. The elution from each previous step is used for the next step. Predict the polypeptide to separate out from the mixture at each step of the following chromatography scheme. Be careful! Consider whether you would have any complexes forming. 1. Sucrose Gradient II. Gel filtration chromatography III. Cation Exchange chromatography 2. Draw the SDS-PAGE and the native PAGE for this mix of proteins. Consider whether you would have any complexes forming. (Average amino acid weights 110Da )

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock blur-text-image

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Chemistry Questions!

Problem 6-13 (Algo) Long-term contract; revenue recognition over time vs. upon project completion [LO6-9] Citation Bulders, Incorporated, builds office buildings and single-family homes. The office...

Given a mixture of the following polypeptides: TTSAAYDRAVALAISLLYYVISLLDDKAVASLLATYSSLATSSVTYSSLA LLWVAFGAVWYINCCVAILLINDWLVVVAILLALLQVAFGLYINCCVAILLINDWYVVVAILLAVVAILLALLQVALLQVAFGLYIN...

W11020 PILLSBURY COOKIE CHALLENGE Natalie Mauro wrote this case under the supervision of Professor Allison Johnson solely to provide material for class discussion. The authors do not intend to...

chegg.com/homework-help/questions-and-answers/1-describe-vertical-chain-biotechnology-productions-make The CRP-1 Project: Current Applications Since Nucleon's founding, its main development project...

Nucleon 1) Describe the vertical chain for biotechnology productions. What "make" decisions has Nucleon already made? What "buy" decisions has it already made? Evaluate these decisions. 2) Draw a...

Using the case study listed below, I need help with the following question Which option do you think management should take and provide justification? Think about this as you have two stages of...

37.2021 X C 1) Describe The Vertical Chain Fo x Study.com - Search for courses, I x +...

I need to see the SPSS output. You need to have all z-scores, all charts, all descriptives data from SPSS, everything you used to answer the questions. I am sending you what the previous tutor sent...

Jones & Bartlett Learning, LLC. NOT FOR RESALE OR DISTRIBUTION CHAPTER Hot Spot Analysis 10 LEARNING OBJECTIVES C A R R Provide a working definition of a \"hot spot.\" , Be able to explain different...

. business is trying to achieve and what they are expected to do in their jobs. She knows that departmental managers should set and contribute targets more but doesn't know how to engage her...

CALCULATIONS 2. +/- R2 = Vterm,BSA +/- R2 = Vterm, lysozyme Vterm,BSA 3. = Vterm,lysozyme M = M 4. % diff = [ratioexp - ratioacc * 100 = * 100 = ratioacc Sratioexp = | ratioexp - ratio acc |= Compare...

1-Which of the following reflect trends in globalinequality a. people living on less than $1.25 a day b. children born dangerously underweight and infantmortality c. internet access d. all of the...

Airplane leases. A corporation wants to lease a fleet of 12 airplanes with a combined carrying capacity of 220 passengers. The three available types of planes carry 10,15, and 20 passengers,...

Use the spot rate curve from the slides and assume coupon payments are made semiannually. a . What is the value, dollar duration, and duration of a \ ( 1 0 \ % \ ) 2 - year Treasury issue? b ....

Exercise 13-10 (Algo) Analyzing efficiency and profitability LO P3 [Alternate Version] Skip to question [The following information applies to the questions displayed below.] Simon Companys year-end...

=+ 3. The residents of a certain dormitory have collected the following data: People who live in the dorm can be classifi ed as either involved in a relationship or uninvolved. Among involved

=+that if unemployment is above the natural rate, unemployment falls, and if unemployment is below the natural rate, unemployment rises.)

=+ b. From your estimates, calculate (in a rate per week) your rate of job fi nding f and your rate of job separation s. (Hint: If f is the rate of job fi nding, then the average spell of...