FREE Trial

A 60.0-m-long brass rod is struck at one end. A person at the other end hears two sounds as a

Question:

A 60.0-m-long brass rod is struck at one end. A person at the other end hears two sounds as a result of two longitudinal waves, one traveling in the metal rod and the other traveling in air. What is the time interval between the two sounds? (The speed of sound in air is 344 m/s; see Tables 11.1 and 12.1 for relevant information about brass.)


Table 11.1

Approximate Elastic Moduli Young's Modulus, Ү (Ра) Bulk Modulus, Shear Modulus, S (Pa) Material B (Pa) Aluminum 7.0 x


Table 12.1

Densities of Some Common Substances Material Density (kg/m³)* Material Density (kg/m³)* Air (1 atm, 20°C) 1.20 Iron,

Transcribed Image Text:

Approximate Elastic Moduli Young's Modulus, Ү (Ра) Bulk Modulus, Shear Modulus, S (Pa) Material B (Pa) Aluminum 7.0 x 1010 7.5 x 1010 2.5 x 1010 Brass 9.0 x 10" 6.0 x 10" 3.5 x 1010 Copper 11 x 100 14 x 1010 4.4 x 1010 Iron 21 x 1010 16 x 1010 7.7 x 1010 Lead 1.6 x 1010 4.1 x 1010 0.6 x 1010 Nickel 21 x 1010 17 x 1010 7.8 x 1010 Silicone rubber 0.001 x 1010 0.2 x 1010 0.0002 x 100 Steel 20 x 1010 16 x 1010 7.5 x 1010 Tendon (typical) 0.12 x 1010 Densities of Some Common Substances Material Density (kg/m³)* Material Density (kg/m³)* Air (1 atm, 20°C) 1.20 Iron, steel 7.8 x 103 Ethanol 0.81 x 103 Brass 8.6 x 103 Benzene 0.90 x 103 Copper 8.9 x 103 Ice 0.92 x 10 Silver 10.5 x 10 Water 1.00 x 103 Lead 11.3х 103 Seawater 1.03 х 109 Mercury 13.6 x 103 Blood 1.06 x 10* Gold 19.3 x 10 Glycerine 1.26 x 103 Platinum 21.4 x 103 Concrete 2 x 103 White dwarf star 1010 Aluminum 2.7 x 103 Neutron star 1018

This problem has been solved!


Do you need an answer to a question different from the above? Ask your question!

Step by Step Answer:

Answer rating: 87% (8 reviews)

IDENTIFY and SET UP Use t distance speed Calculate the time it takes each sound wave to travel th…View the full answer


answer-question
Answered By
tutor-profile-image
Joseph Mwaura
I have been teaching college students in various subjects for 9 years now. Besides, I have been tutoring online with several tutoring companies from 2010 to date. The 9 years of experience as a tutor has enabled me to develop multiple tutoring skills and see thousands of students excel in their education and in life after school which gives me much pleasure. I have assisted students in essay writing and in doing academic research and this has helped me be well versed with the various writing styles such as APA, MLA, Chicago/ Turabian, Harvard. I am always ready to handle work at any hour and in any way as students specify. In my tutoring journey, excellence has always been my guiding standard.
4.00+ 1+ Reviews 10+ Question Solved
Related Book For  answer-question
University Physics with Modern Physics

University Physics with Modern Physics

ISBN: 978-0133977981

14th edition

Authors: Hugh D. Young, Roger A. Freedman

See More Books
Question Details
Chapter # 16
Section: Exercises
Problem: 11
View Solution
Create a free account to access the answer
Cannot find your solution?
Post a FREE question now and get an answer within minutes. * Average response time.
Question Posted: October 30, 2018 12:07:49
See More Questions

Related Video

In this video, A mixture of methanol and air in a large polycarbonate bottle is ignited. The resulting rapid combustion reaction, often accompanied by a dramatic ‘whoosh’ sound and flames, demonstrates the large amount of chemical energy released in the combustion of alcohol

Students also viewed these Physics questions

Q:
An 80.0-m-long brass rod is struck at one end. A person at b the other end hears two sounds as a result of two longitudinal waves, one traveling in the metal rod and the other traveling in the air....
A:
IDENTIFY and SET UP Use distance speed Calculate th......
Q:
A brass rod is 185 cm long and 1.60 cm in diameter. What force must be applied to each end of the rod to prevent it from contracting when it is cooled from 120.0C to 10.0C?
A:
IDENTIFY Apply Eq 17 12 and solve for F SET U......
Q:
1. A brass rod 1.020 m long expands 3.0 mm when it is heated. Find the temperature change. 2. The road bed on a bridge 500.0 ft long is made of concrete. What allowance is needed for temperatures of ...
A:
1 2 3 4......
Q:
Implement a generic Map that supports the put and get operations. The implementation will store a hash table of pairs (key, definition). Figure 5.55 provides the Map specification (minus some...
A:
public class Map KeyType ValueType public Map items new QuadraticProbingHashTable public void put Ke......
Q:
If an electric wire is allowed to produce a magnetic field no larger than that of the Earth (0.50 10-4 T) at a distance of 12 cm from the wire, what is the maximum current the wire can carry?
A:
We assume that the wire is lon......
Q:
In the circuit of Fig. 12.54, if Vab = 440 10°, Vbc = 440 250°, Vca = 440 130° V, find the line currents. 3+/2 10-18 Vsa 10-j8
A:
Convert the delta connected sourc......
Q:
The three elements of the fraud triangle are a perceived pressure, a perceived opportunity, and rationalization. (True/False)
A:
True The three elements of the fraud tri......
Q:
One of the major financial scandals of the twentieth century centered on McKesson & Robbins. The case had implications for the audit of accounts receivable. Based on appropriate research, describe...
A:
Respondents often find this research project to be very engaging They find the life details o......
Q:
1-Find P.O & Ts. (2marks) 2-compare the two step Responses. (1 marks) 3-In two subplots (one figure) plot the position of the Zeros & Poles. (1marks) 4-print the step information of both systems....
A:
Click to View...
Q:
A bit stream 10011101 is transmitted using the standard CRC method described in the text. The generator polynomial is x3 + 1. Show the actual bit string transmitted. Suppose the third bit from the...
A:
The frame is 10011101 The generator is 1001 The message after appending three zeros is......
Q:
Does the sound intensity level b obey the inverse-square law? Why?
A:
No The sound intensity level is given by If obeyed the inverse square law doubling r would ch......
Q:
A small fraction of the energy in a sound wave is absorbed by the air through which the sound passes. How does this modify the inverse square relationship between intensity and distance from the...
A:
The inverse square relationship......
Q:
Solve each equation. (x + 1) 2/5 - 3(x + 1) /5 + 2 = 0
A:
This is a true statement O is a solution Check x 31 This is a true sta......
Q:
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
A:
RRPVVLMAACLRPVVFITYGDGGTYYHWYH It s not possible to predict the exact secondary structure of this re......
Q:
A Leu Ala mutation at a site buried in the core of the enzyme lysozyme is found to be destabilizing. Explain the observed effect of this mutation on lysozyme stability by predicting how enthalpy...
A:
A Leu Ala mutation at a buried site in the core of the enzyme lysozyme is expected to have several e......
Q:
Antibodies raised against a macromolecular antigen (e.g., a protein) generally form an antigen-Ab precipitate when mixed with the antigen at roughly equimolar concentrations. However, little to no...
A:
The observation that antibodies raised against a macromolecular antigen generally form an antigen antibody Ag Ab precipitate when mixed with the antig......
Q:
In the protein adenylate kinase, the C-terminal region has the sequence The hydrophobic residues in this sequence are presented in boldface type. Suggest a possible reason for the periodicity in...
A:
The periodicity in the spacing of hydrophobic residues in a protein sequence can be indicative of st......
Q:
Hemoglobin Rainier (HbR) is a mutant in which Tyr 145 of the -globin is replaced by Cys. This Cys forms an intramolecular disulfide with Cys93 in the oxy state but cannot form the intramolecular...
A:
a The O2 binding affinity of disulfide bonded HbR is expected to be lower than that of normal adult HbA The formation of the intramolecular disulfide......
Q:
Explain why the inhomogeneity factor, , in rod and wire drawing depends on the ratio h/L as plotted in Fig. 6.12
A:
The graph showing the variation of in homogeneity facto......
Q:
What are the before image (BFIM) and after image (AFIM) of a data item? What is the difference between in-place updating and shadowing, with respect to their handling of BFIM and AFIM?
A:
Before image is the old copy of data item prior to updating and After image is a new value o......
Q:
A 5.00-kg chunk of ice is sliding at 12.0 m/s on the floor of an ice-covered valley when it collides with and sticks to another 5.00-kg chunk of ice that is initially at rest. Since the valley is...
A:
Identify During the collision momentum is conserved but after the collision mechanical energy is con......
Q:
(a) When an object is in a circular orbit of radius r around the earth (mass ), the period of the orbit is T, given by Eq. (13.12), and the orbital speed is given by Eq. (13.10). Show that when the...
A:
Identify In Eqs 13 12 and 13 16 replace T by T T and r by r r Use the expression in the hint to simp......
Q:
A shaft is drilled from the surface to the center of the earth (see Fig. 13.24). As in Example 13.10 (Section 13.6), make the unrealistic assumption that the density of the earth is uniform. With...
A:
Identify Compare F E to Hookes law Set Up The earth has mass and radius Execute a Fo......
An Introduction To Random Vibrations Spectral And Wavelet Analysis 3rd Edition - ISBN: 0486442748 - Free Book