Why is a type O individual considered a universal blood donor? Why is a type AB individual
Question:
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 50% (6 reviews)
A type O individual does not produce the antigenic A or B oligosaccharides a...View the full answer
Answered By
PALASH JHANWAR
I am a Chartered Accountant with AIR 45 in CA - IPCC. I am a Merit Holder ( B.Com ). The following is my educational details.
PLEASE ACCESS MY RESUME FROM THE FOLLOWING LINK: https://drive.google.com/file/d/1hYR1uch-ff6MRC_cDB07K6VqY9kQ3SFL/view?usp=sharing
3.80+
3+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts and Connections
ISBN: 978-0321839923
1st edition
Authors: Dean R. Appling, Spencer J. Anthony Cahill, Christopher K. Mathews
Question Posted:
Students also viewed these Medical Sciences questions
-
In another test, the valve of a 500-L cylinder full of the gas mixture at 2000 psi (gauge pressure) is opened wide so that the gas rushes out of the cylinder very rapidly. Why might some N 2 O...
-
Why is rotational latency usually not considered in disk scheduling? How would you modify SSTF, SCAN, and C-SCAN to include latency optimization?
-
For each of the following compounds, identify all groups that would be considered substituents, and then indicate how you would name each substituent. (a) (b) (c) (d) (e) (f) (g)
-
Fill in the blanks in the chart below: Year Years since 1960 1960 1965 1970 1975 1980 1985 1990 1995 1996 1997 1998 1999 2000 2001 2003 2005 2006 2007 2008 2009 2010 2011 0 5 [a] [b] [c] [d] [e] [f]...
-
On January 1, 2010, Sampress Company adopts a compensatory share option plan for its 50 executives. The plan allows each executive to purchase 200 shares of its $2 par common stock for $30 per share...
-
Using the government budget constraint, explain: a. Why some countries experience hyperinflation. b. How fiscal policy must change in order to implement a noninflationary monetary policy.
-
List various types of gears.
-
The management of Madeira Manufacturing Company is considering the introduction of a new product. The fixed cost to begin the production of the product is $30,000. The variable cost for the product...
-
Q1. Jassim Compagny is producing only one product. Two types of direct materials are used to produce this product: direct material type( A) and direct material type B. The estimated data for Jassim...
-
Alden Company uses a three-variance analysis for factory overhead variances. Practical capacity is defined as 32 setups and 32,000 machine hours to manufacture 6,400 units for the year. Selected data...
-
Provide an explanation for the fact that -D-mannose is more stable than -D-mannose, whereas the opposite is true for glucose.
-
The disaccharide α, β-trehalose differs from the α, α structure in Figure 9.14(a) by having an (a1β1) linkage. Draw its structure as...
-
Why does a consumer spend the entire budget?
-
Microsoft had changed its pay strategy to rely less on stock options, more on stock grants, and then to rely less on stock grants and more on cash as its product cycle phase changed from growth to...
-
Discuss in detail the equity theory and how employees perceive fairness.
-
Making a decision for the location of your business or organization is of great importance: for a variety of reasons. After studying chapter 8, discuss why you feel it of importance and how the...
-
Gordon was a food services attendant at Arlington Home for the Aged. His job description included preparing food and assisting residents who could not feed themselves. Gordon had been working with...
-
Discuss the similarity and difference between transformational leadership theories and behavioral leadership theories. Explain briefly
-
Coatmin is a government-controlled bank. Coatmin was taken over by the government during the recent financial crisis. Coatmin does not directly trade with other government-controlled banks but has...
-
ABC company leased new advanced computer equipment to STU Ltd on 1 January 2019.STULtd has to pay annual rental of $290,000 starting at 1 January 2019. It is a four years lease with ultimate rental...
-
In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...
-
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
What is the balance in Work in Process Inventory at the end of each month? Work in Process Inventory April 30 $ May 31 A 10,140 15,950 June 30 $ 10,450
-
Sako Company s Audio Division produces a speaker used by manufacturers of various audio products. Sales and cost data on the speaker follow: Selling price per unit on the intermediate market $ 6 0...
-
Vulcan Company's contribution format income statement for June is as follows: Vulcan Company Income Statement For the Month Ended June 30 Sales Variable expenses Contribution margin Fixed expenses...
Study smarter with the SolutionInn App