Question: Why is a type O individual considered a universal blood donor? Why is a type AB individual considered a universal acceptor?

Why is a type O individual considered a universal blood donor? Why is a type AB individual considered a universal acceptor?

Step by Step Solution

★★★★★

3.45 Rating (165 Votes )

There are 3 Steps involved in it

1 Expert Approved Answer
Step: 1 Unlock

A type O individual does not produce the antigenic A or B oligosaccharides a... View full answer

blur-text-image
Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock
Step: 3 Unlock

Document Format (1 attachment)

Word file Icon

811-M-S-B-C (635).docx

120 KBs Word File

Students Have Also Explored These Related Biochemistry Questions!

Q:

In another test, the valve of a 500-L cylinder full of the gas mixture at 2000 psi (gauge pressure) is opened wide so that the gas rushes out of the cylinder very rapidly. Why might some N 2 O...

Q:

Why is rotational latency usually not considered in disk scheduling? How would you modify SSTF, SCAN, and C-SCAN to include latency optimization?

Q:

For each of the following compounds, identify all groups that would be considered substituents, and then indicate how you would name each substituent. (a) (b) (c) (d) (e) (f) (g)

Q:

check anwers for me please if wrong please let me know What antigens are found on the red blood cells of a person with typel BA? Asking RH , B A person with blood type A- needs a blood transfusion...

Q:

62.63.52.23.24.25.26 Use a normal approximation to find the probability ofthe indicated number of voters. In this case, assume that 156 eligible voters aged 18-24 are randomly selected. Suppose a...

Q:

a There is a hospital with a blood donation section with five units next to each other. One day after five women donated blood simultaneously, the secretary forgot to take their record, and managers...

Q:

PHP PROGRAMMING Every fall local Purple Square organizes a blood drive. Participants donate blood to help people who need blood transfusions. Use the techniques you learned in Chapter 6 to create a...

Q:

2. Seven patients require blood transfusions. We assure four blood types: A, AB, B, and O. Type AB is called the universal recipient; type O is called the universal donor. The blood supply and...

Q:

2. Seven patients require blood transfusions. We assume four blood types: A, AB, B, and O. Type AB is called the universal recipient; type O is called the universal donor. The blood supply and...

Q:

Every fall local Purple Square organizes a blood drive. Participants donate blood to help people who need blood transfusions. Use the techniques you learned in Chapter 6 to create a "Save A Life"...

Q:

The following calendar year-end information is taken from the December 31, 2019, adjusted trial balance and other r Company Advertising expense Depreciation expense-Office equipment Depreciation...

Q:

It has been nine months since you opened your business, and you are off to a flying start. You have hired and trained your team, your prospects look good and it is clear you will need to bring on...

Q:

By expanding etx in a Maclaurin series and integrating term by term, show that MX(t) =

Q:

The challenging targets for 2050 for sustainable freight transport in European Union (EU) combine A. A reduction of EU CO2 emissions from maritime bunker fuel by 40% - 50% B. A reduction of...

Q:

In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...

Q:

Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?

Q:

The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .

Q:

Consider three bonds with 5.4% coupon rates, all making annual coupon payments and all selling at a face value of $1,000. The short-term bond has a maturity of 4 years, the intermediate-term bond has...

Q:

Suppose someone wants to accumulate $ 4 0 comma 0 0 0 for a college fund over the next 1 5 years. Determine whether the following investment plans will allow the person to reach the goal. Assume the...

Q:

Digital Inc. is considering production of a new cell phone. The project will require an investment of $20 million. If the phone is well-received, the project will produce cash flows of $10 million a...