Question: 5. The following three polypeptides are present in a mixture at pH=7.0. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG GPYFGDEPLDVHDEPEEG PHLLSAWKGMEGVGKSQSFAALIVILA Of the three, which would migrate the most slowly through:

5. The following three polypeptides are present in a mixture at pH=7.0. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG GPYFGDEPLDVHDEPEEG PHLLSAWKGMEGVGKSQSFAALIVILA Of the three, which would migrate the most slowly through: a. Anion exchange resin (explain) b. Cation exchange resin (explain) c. A size exclusion column designed to separate small peptides (explain)

Step by Step Solution

There are 3 Steps involved in it

1 Expert Approved Answer

Step: 1 Unlock blur-text-image

Question Has Been Solved by an Expert!

Get step-by-step solutions from verified subject matter experts

Step: 2 Unlock

Step: 3 Unlock

Students Have Also Explored These Related Chemistry Questions!

Chromatographic Methods Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture: Peptide 1:...

5. The following three cases make different assumptions with respect to the amounts of Income and deductions of Ms. Tanya Saints for the current year. What is the net income for tax purposes, and the...

Exercise 4 The spot rates now are: One-year rate= Two-year rate= Three-year rate = 3.02% 3.7% 4.47% The spot rates in one year are expected to be: One-year rate 4.38% Two-year rate= 5.2% Three-year...

Exercise 5 The following three zero coupon bonds have $1000 as face value and the Maturity in years Price 1 966.56 923.31 2. 3 869.79 A bond has a face value of $1000 a coupon rate of 5% and matures...

Exercise 5 The following three zero coupon bonds have $1000 as face value and the Maturity in years Price 968.43 925.27 872.53 3 A bond has a face value of $1000 a coupon rate of 6.5% and matures in...

Exercise 5 The following three zero coupon bonds have $1000 as face value and the Maturity in years I Price 1 2 3 963.86 918.54 858.92 A bond has a face value of $1000 a coupon rate of 6% and matures...

QUESTION 3 Answer saved Marked out of 8.00 P Flag question EXERCISE 2 (consists of Question 3, 4 and 5) The following three exercises do belong together. Assume that we have five assets. The first...

* * * 4 . 1 7 In this problem we perform five successive accesses to memory. The following table shows for each access whether it is a read ( load ) or write ( store ) , and the contents of the MAR...

Short Answer .. [2] 5 The following three diagrams show three possible lines of best fit for a group of data. Which line is the best fit for the data? Explain your answer. Line A Line B Line C...

5. The following three graphs illustrate the sales of two products Series 1 and Series 2 for each quarter of 2019. Which is the most effective in conveying the information?

Some HR managers use the Ulrich HR model for strategic planning. The model provides an overall view of the role of HRM in an organization. What does this model consist of? What are the five main...

Easy Limited specializes in the manufacture of a computer component. The component is currently sold for Rs 1,000 and its variable cost is Rs 800. For the current year ended December 31, the company...

9. Silverman Company purchased machinery for $162,000 on January 1, 2025. It is estimated that the machinery will have a useful life of 20 years, residual value of $15,000, production of 84,000...

4. Rewrite the following do loop into a while loop. (0.5 point) int n; double x = 0; double s cout > n cout 0.01)

In what way is a celebrity or politician a brand?

How does a brands portfolio management impact on IMC strategy?

Select a brand that you feel has strong brand equity and discuss the role of brand attitude in building and sustaining it.